KEGG   Mus caroli (Ryukyu mouse): 110286671
Entry
110286671         CDS       T05910                                 

Gene name
Xiap
Definition
(RefSeq) E3 ubiquitin-protein ligase XIAP isoform X1
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04064  NF-kappa B signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04510  Focal adhesion
mcal04621  NOD-like receptor signaling pathway
mcal05145  Toxoplasmosis
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110286671 (Xiap)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110286671 (Xiap)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110286671 (Xiap)
   04215 Apoptosis - multiple species
    110286671 (Xiap)
   04217 Necroptosis
    110286671 (Xiap)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110286671 (Xiap)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110286671 (Xiap)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286671 (Xiap)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110286671 (Xiap)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110286671 (Xiap)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110286671 (Xiap)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110286671 (Xiap)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110286671 (Xiap)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110286671 (Xiap)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110286671 (Xiap)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110286671 (Xiap)
Peptidases and inhibitors [BR:mcal01002]
 Peptidase inhibitors
  Family I32: IAP family
   110286671 (Xiap)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110286671 (Xiap)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    110286671 (Xiap)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 110286671
NCBI-ProteinID: XP_021008861
Ensembl: MGP_CAROLIEiJ_G0033024
UniProt: A0A6P5P4Q3
LinkDB
Position
X
AA seq 603 aa
MVKAVLLSISYIWVYHILFCKKVSMRSHSECSQQAGACRPAELCFPDPGSGRPSSGTLPS
GTRRPRRLVRTGVLGATCWRRTNYLATLPRTQLTPFEKVDKSYFPEKMTFNSFEGTRTFV
PADTNKDEEFVLEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDTVQCFSCHAAIDRW
QYGDSAVGRHRRISPNCRFINGFYFENGAAQSTSPGIQNGQYKSENCVGNRNPFALDRPS
ETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTG
TDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNST
NSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSE
DPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNP
MVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTQDESSQTSLQKD
ISTEEQLRRLQEEKLCKICMDRNIAVVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKI
FMS
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggtcaaagcagttctgctttctatctcctatatttgggtttatcatatattgttttgc
aaaaaggtttcgatgcgaagccattctgagtgctctcagcaggccggggcctgccgccca
gcagagttgtgttttcctgatccgggctcgggccgcccctcctccgggaccctcccctcg
ggaacccgtcgcccgcggcgcttagttaggactggagtgcttggcgcgacctgttggagg
aggacaaactatcttgccactcttcccagaacccagctgactccttttgaaaaggtggac
aagtcctattttccagagaagatgacttttaacagttttgaaggaactagaacttttgta
cctgcagacaccaataaggatgaagaatttgtattagagtttaatagattaaaaacattt
gctaacttcccaagtagtagtcctgtttcagcatcaacattggcgcgagctgggtttctt
tataccggtgaaggagacaccgtgcaatgtttcagttgtcacgcggcaatagatagatgg
cagtatggagactcagctgttggaagacacaggagaatatccccaaattgcagatttatc
aatggtttttattttgaaaacggtgccgcacagtctacaagtcctggtatccaaaatggc
cagtacaaatctgaaaactgtgtgggaaacagaaatccttttgcccttgacaggccatct
gagactcatgccgattatctcttgagaactggacaggttgtagatatttcagacaccata
tacccgaggaaccctgccatgtgtagtgaagaagccagactgaagtcatttcagaactgg
ccggactatgctcatttaacccccagagagttagctagtgctggcctctactacacaggg
actgatgatcaagtgcaatgcttttgttgtgggggaaaactgaaaaattgggaaccctgt
gatcgtgcctggtcagaacacaggagacactttcctaattgcttctttgttttgggccgg
aatgttaatgttcgaagtgaatctggtgtgagttctgataggaatttcccaaattcaaca
aactctccaagaaatccagccatggcagaatatgaagcacggatcgttacttttggaacg
tggacatcttcagttaacaaggagcagcttgcaagagctggattttatgctttaggtgaa
ggcgataaagtgaagtgctttcactgtggaggagggctcacagattggaagccaagtgaa
gacccttgggaacagcatgcaaagtggtatccagggtgtaaatacctattggatgagaag
gggcaagaatatataaataatattcatttaacccattcacttgaggaatctttgggaaga
actgctgaaaaaacaccatctctaactaaaaaaattgatgataccatcttccagaatcct
atggtgcaagaagctatacgaatgggatttagcttcaaggacattaagaaaacaatggaa
gaaaaaatccaaacatctgggagcagttatctatcacttgaggtcctgattgcagatctt
gtgagtgctcagaaagataatacacaggatgagtcaagtcaaacttcattgcagaaagac
attagtactgaagagcagctaaggcgcctacaagaggagaagctttgcaaaatctgtatg
gatagaaatattgctgtcgtttttgttccctgtggacatctggtcacttgtaaacagtgt
gctgaagcagttgacaaatgtcccatgtgctacaccgtcattacgttcaagcaaaaaatt
tttatgtcttag

KEGG   Mus caroli (Ryukyu mouse): 110290468
Entry
110290468         CDS       T05910                                 

Gene name
Birc7
Definition
(RefSeq) baculoviral IAP repeat-containing protein 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04215  Apoptosis - multiple species
mcal05145  Toxoplasmosis
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110290468 (Birc7)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    110290468 (Birc7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290468 (Birc7)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110290468 (Birc7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110290468 (Birc7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110290468 (Birc7)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110290468 (Birc7)
Peptidases and inhibitors [BR:mcal01002]
 Peptidase inhibitors
  Family I32: IAP family
   110290468 (Birc7)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110290468 (Birc7)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-RING_2 DUF2039 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4 ArfGap
Other DBs
NCBI-GeneID: 110290468
NCBI-ProteinID: XP_021012675
Ensembl: MGP_CAROLIEiJ_G0024791
UniProt: A0A6P5PDT2
LinkDB
Position
2
AA seq 285 aa
MFSPADLFRAAVFPTGPESRARDSVCGPELSHREDGNGCTQEQDKPHCPCNHVLGQDCLD
GQILGQLRPLSEEEESSGATFLGEPAFPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFF
HTGQQDKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRDFVERIQAYTPLLG
SWDQREEPEDAVSATPSAPAHGSPELLRSRRETQPEDVSEPGAEDVQEQLRQLQEERRCK
VCLDRAVSIVFVPCGHFVCTECAPNLQLCPICRVPICSCVRTFLS
NT seq 858 nt   +upstreamnt  +downstreamnt
atgttctcacctgcagacttgttcagagctgctgtctttcccacggggcctgagagtagg
gccagggactcggtctgtggcccagagctaagccacagggaagatggcaatggctgcaca
caggagcaggataaaccccactgtccgtgtaaccatgtcctgggccaggactgcctagat
gggcagatcttaggccagttgcggcctctgtcagaagaggaagaatcctctggggctacc
ttccttggggagcccgctttccctgagatggactcagaggatctccgtctagcctccttc
tacgactggccatctactgcggggattcagcctgagccattggctgctgctggattcttc
cacacaggccagcaggacaaggtgagatgtttcttctgctatgggggtctacagagctgg
gagcgtggggatgacccctggacagagcatgcccgatggttccccaggtgtcagttcctg
ctacggtcaaaaggaagggactttgtggaaagaatccaggcctacacccccttgctggga
tcctgggatcagcgagaagaaccagaagatgcagtctctgccactccctcagctcctgcc
catggaagccctgagttactcagatccagaagagagacccagcctgaagatgtcagtgag
ccaggagctgaggatgttcaggaacagctgcgacagctgcaggaagagaggagatgcaag
gtgtgcctggaccgagcngtctccatagtcttcgtgccctgtggccacttcgtctgcacc
gagtgtgcccccaacctgcagctgtgccctatctgcagggtncctatctgtagctgtgta
cgcacattcctgtcctaa

KEGG   Mus caroli (Ryukyu mouse): 110301861
Entry
110301861         CDS       T05910                                 

Gene name
Birc2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04064  NF-kappa B signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04390  Hippo signaling pathway
mcal04510  Focal adhesion
mcal04621  NOD-like receptor signaling pathway
mcal04668  TNF signaling pathway
mcal05132  Salmonella infection
mcal05145  Toxoplasmosis
mcal05168  Herpes simplex virus 1 infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110301861 (Birc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110301861 (Birc2)
   04064 NF-kappa B signaling pathway
    110301861 (Birc2)
   04668 TNF signaling pathway
    110301861 (Birc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110301861 (Birc2)
   04215 Apoptosis - multiple species
    110301861 (Birc2)
   04217 Necroptosis
    110301861 (Birc2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110301861 (Birc2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110301861 (Birc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301861 (Birc2)
   05202 Transcriptional misregulation in cancer
    110301861 (Birc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110301861 (Birc2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110301861 (Birc2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110301861 (Birc2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110301861 (Birc2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110301861 (Birc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110301861 (Birc2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110301861 (Birc2)
Peptidases and inhibitors [BR:mcal01002]
 Peptidase inhibitors
  Family I32: IAP family
   110301861 (Birc2)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110301861 (Birc2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 110301861
NCBI-ProteinID: XP_021028204
Ensembl: MGP_CAROLIEiJ_G0031761
UniProt: A0A6P5QJK2
LinkDB
Position
9
AA seq 591 aa
MENSTILSNWTKESEEKMKFDFSCELYRMSTYSAFPRGVPVSERSLARAGFYYTGMNDKV
KCFCCGLMLDNWKQGDSPVEKHRQFYPSCSFVQTLLSASLQSPSKNMSPVKSRFAHSSPL
EQGGIHSNLCSSPLNSRAVEDFSSRMDPCSYAMSTEEARFLTYSMWPLSFLSPAELARAG
FYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPHCPFLENTSETQRFSISNLSMQT
HSARLRTFLYWPSSVPVQPEQLASAGFYYVDRNDDVKCFCCDGGLRCWEPGDDPWIEHAK
WFPRCEFLIRMKGQEFVDEIQARYPHLLEQLLSTSDTPGEENADPTETIVRFGPGESSED
VVMMSTPVVKAALEMGFSRSLVRQTVQRQILATGENYRTVNDIVSVLLNAEDERREEEKE
RQTEEMASGDLSLIRKNRMALFQQLTHVLPILDNLLEASVITKQERDIIRQKTQIPLQAR
ELIDTVLVKGNAAANIFKNSLKEIDSTLYESLFVEKNMKYIPTEDVSGLSLEEQLRRLQE
ERTCKVCMDREVSIVFIPCGHLVVCQECAPSLRKCPICRGTIKGTVRTFLS
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggagaatagcacaatcttgtcaaattggacaaaggagagcgaagaaaaaatgaagttt
gacttttcgtgtgaactctacagaatgtccacatattcagcttttcccaggggggttcct
gtctcagagaggagtctggctcgtgctggcttttattatacaggtatgaatgacaaagtc
aagtgcttctgctgtggcctgatgttggataactggaaacaaggggacagtcctgttgag
aagcacagacagttctatcccagctgcagctttgtacagactctgctttcagccagtctg
cagtctccatctaagaatatgtctcctgtgaaaagtagatttgcacattcgtcacctctg
gaacaaggtggcattcactccaacctgtgctctagccctcttaattctagagcagtggaa
gacttctcatcaaggatggatccctgcagctatgccatgagtacagaagaggccagattt
cttacttacagtatgtggcctttaagttttctgtcaccagcagagctggccagagctggc
ttctattacatagggcctggagacagggtggcctgttttgcctgtggtgggaagctgagc
aactgggaaccaaaggacgatgctatgtcagagcaccgcagacattttccccactgtcca
tttctggaaaatacttcagaaacacagaggtttagtatatcaaatctaagtatgcagaca
cactctgctcggttgaggacatttctttactggccatctagtgttcctgttcagcccgag
cagcttgcaagtgctggattctattacgtggatcgaaatgatgatgtcaagtgcttttgt
tgtgatggtggcttgagatgttgggaacccggagatgacccctggatagaacacgccaaa
tggtttccaaggtgtgagttcttgatacggatgaagggtcaggagtttgttgatgagatt
caagctagatatcctcatcttcttgagcagctgttgtccacttcagacaccccaggagaa
gaaaatgctgaccctacagagacaattgtgcgttttggccctggagaaagttcggaagac
gtcgtcatgatgagcacgcctgtggttaaagcagccttggaaatgggctttagtaggagc
ctggtgagacagacggttcagcgtcagatcctggccactggtgagaactacaggaccgtc
aatgatattgtttcagtacttttgaatgctgaagatgaaagaagagaagaggagaaggaa
agacagactgaagagatggcatcaggtgacttgtcgctgattcggaagaataggatggcc
ctctttcaacagttgacacatgtccttcctatcctggataatcttcttgaggccagtgta
attacaaaacaggaacgtgatattattagacagaaaacacagatacccttacaagcaaga
gagcttattgatactgttttagtcaagggaaatgctgcagccaacatcttcaaaaactct
ctgaaggaaattgactccacattatatgaaagcttatttgtggaaaagaatatgaagtat
attccaacagaagacgtttccggcttgtcattggaagaacagttgcggagattacaagaa
gaacgaacttgcaaagtgtgtatggacagagaggtttctattgtgttcattccttgtggt
catctagtagtctgccaggaatgtgccccttctctaaggaagtgccccatctgcaggggg
acaatcaaggggactgtgcgcacatttctctcatga

KEGG   Mus caroli (Ryukyu mouse): 110302303
Entry
110302303         CDS       T05910                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04064  NF-kappa B signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04390  Hippo signaling pathway
mcal04510  Focal adhesion
mcal04621  NOD-like receptor signaling pathway
mcal04668  TNF signaling pathway
mcal05132  Salmonella infection
mcal05145  Toxoplasmosis
mcal05168  Herpes simplex virus 1 infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110302303
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110302303
   04064 NF-kappa B signaling pathway
    110302303
   04668 TNF signaling pathway
    110302303
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110302303
   04215 Apoptosis - multiple species
    110302303
   04217 Necroptosis
    110302303
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110302303
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110302303
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302303
   05202 Transcriptional misregulation in cancer
    110302303
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110302303
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110302303
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110302303
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110302303
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110302303
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110302303
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110302303
Peptidases and inhibitors [BR:mcal01002]
 Peptidase inhibitors
  Family I32: IAP family
   110302303
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110302303
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 110302303
NCBI-ProteinID: XP_021028804
Ensembl: MGP_CAROLIEiJ_G0031762
UniProt: A0A6P5QEW4
LinkDB
Position
9
AA seq 602 aa
MNMVQDSAFLAKLMKSADTFELKYDFSCELYRLSTYSAFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKPGDSPIEKHRKLYPSCNFVQTLNPANSLEASPQPSPPSTAMST
MPLCFASSENTGYFSGSYSSFPSDPVNFRANQDRPALSTSPYHFAMNTEKARLLTYETWP
LSFLSPAKLAKAGFYYIGPGDRVACFACDGKLSNWERKDDAMSEHQRHFPSCPFLKDLGQ
SASRYTASNLSMQTHAARIRTFSNWPSSALVHAQELASAGFYYTGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIRIKGQEFVSQVQAGYPHLLEQLLSTSDSPEDENAEAA
IVHFGPGESSEDVVMMSTPVVKAALEMGFSRSLVRQTVQRQILATGENYRTVSDLVIGLL
DAEDEMREEQMEQAAEEEESDDLALIRKNKMVLFQHLTCVTPMLYCLLSARAITEQECDA
VKQKPHTLQASTLIDTVLAKGNAAATSFRNSLREIDPALYRDIFVQQDIRSLPTDDIAAL
PMEEQLRKLQEERMCKVCMDREVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVRTF
LS
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgaacatggttcaagacagtgcctttctagccaagctgatgaagagtgctgacaccttt
gagttgaagtatgacttttcctgtgagctgtaccgattgtccacatactcagctttccct
gcgggagttcctgtgtcagaaaggagtctggctcgtgctggcttttactacactggtgtc
aatgacaaggtcaagtgcttctgctgtggcctgatgctagacaactggaaaccaggggac
agtcccattgagaagcacagaaagttgtaccccagctgcaactttgtacagactttgaat
ccagccaacagtctggaagctagtcctcagccttctcctccttccacagcgatgagcacc
atgccgttgtgctttgcaagttctgagaacactggctatttcagtggctcttactcaagc
tttccctcagaccctgtgaacttccgagcaaatcaagatcgtcctgctttgagcacaagt
ccctaccactttgcaatgaacacagagaaggccagattactcacctatgaaacatggcca
ttgtcttttctgtcaccagcaaagctggccaaagcaggcttctactacataggacctgga
gatagagtggcctgctttgcgtgtgatgggaaactgagcaactgggaacgtaaggatgat
gctatgtcagagcaccagaggcatttccccagctgcccgttcttaaaagacttgggtcag
tctgcttcgagatacactgcctccaacctgagcatgcagacacacgcagcccgtattaga
acattctctaactggccttctagtgcactagttcatgcccaggaacttgcaagtgcgggc
ttttattacacaggacacagtgatgatgtcaagtgtttttgctgtgatggcgggctgagg
tgctgggaatctggagatgacccctgggtggaacatgccaagtggtttccaaggtgtgag
tacttgatcagaatcaaaggccaagagtttgtcagccaagttcaagctggctatcctcat
ctacttgagcagctattatctacgtcagactccccagaagatgagaatgcagaagcagca
atcgtgcattttggccctggagaaagttcggaagatgtcgtcatgatgagcacacctgtg
gttaaagcagccttggaaatgggcttcagtaggagcctggtgagacagacggttcagcgt
cagatcctggccactggtgagaactacaggaccgtcagtgacctcgttataggcttactg
gatgcagaagacgagatgagagaggagcagatggagcaggcggccgaggaggaggagtca
gatgatctagcattaatccggaagaacaaaatggtgcttttccaacatttgacgtgtgtg
acaccaatgctgtattgcctcctaagtgcaagggccatcactgaacaggagtgcgatgct
gtgaaacagaaaccacataccttacaagcaagcacactgattgatactgtgttagcaaaa
ggaaacgctgcagcgacctcattcagaaactcccttcgggaaattgaccctgcgttatac
agagatatatttgtgcaacaggacattaggagtcttcccacagatgacattgcagctcta
ccaatggaagaacagttgcggaaactccaggaagaaagaatgtgtaaagtgtgtatggac
cgagaggtatccatcgtgttcattccctgtggccatctggtcgtgtgtaaagactgtgct
ccctctctgaggaagtgtcccatctgtagagggaccatcaagggcacagtgcgcacattt
ctctcctga

DBGET integrated database retrieval system