KEGG   Mus caroli (Ryukyu mouse): 110286681
Entry
110286681         CDS       T05910                                 

Gene name
Elk1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04510  Focal adhesion
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04921  Oxytocin signaling pathway
mcal05140  Leishmaniasis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05213  Endometrial cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110286681 (Elk1)
   04012 ErbB signaling pathway
    110286681 (Elk1)
   04014 Ras signaling pathway
    110286681 (Elk1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110286681 (Elk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110286681 (Elk1)
   04912 GnRH signaling pathway
    110286681 (Elk1)
   04921 Oxytocin signaling pathway
    110286681 (Elk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286681 (Elk1)
   05205 Proteoglycans in cancer
    110286681 (Elk1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110286681 (Elk1)
   05213 Endometrial cancer
    110286681 (Elk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110286681 (Elk1)
   05161 Hepatitis B
    110286681 (Elk1)
   05163 Human cytomegalovirus infection
    110286681 (Elk1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110286681 (Elk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110286681 (Elk1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    110286681 (Elk1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 110286681
NCBI-ProteinID: XP_021008880
Ensembl: MGP_CAROLIEiJ_G0032971
UniProt: A0A6P5P4H6
LinkDB
Position
X
AA seq 429 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHA
GPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPIHPRPAS
VLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLDPS
FGHPQPPEVKVEGPKEELEAARAGGFSSEAVKAEPEVSPSEGLLARLPAILTENTAQVCG
LSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAPGPALTPSLLPT
HTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPV
VLSPGPQKP
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagcttctgagagaacaaggtaat
ggccacatcatctcctggacctcacgggatggtggtgagttcaagttggtggacgcagag
gaggtggcccggctatggggactgcgcaagaacaagaccaacatgaattatgacaagctt
agccgggccttgcggtactactatgataagaatatcatccgcaaggtgagcggccagaag
tttgtctacaagtttgtgtcctacccagaggttgcagggtgctccactgaagactgccca
ccccagcctgaggtgtctgtaacctcggccatagccatggcccctgctactgtccatgca
ggcccaggggacactgccactggaaagccaggaacaccaaagggtgcaggaatgacaggc
caaggtggcttagcacgaagcagccggaatgaatacatgcgctcgggcctctattctacc
ttcacaatacagtccctgcagccacagccacagccacccattcatcctcggcctgcctca
gtgcttcccaacactacccctgcaggagtaccagcacccgcctcagggagcaggagcacc
agtccaaaccccttagaagcctgtttggaggcagaagaggctggtctgcccctgcaggtt
atcctaaccccaccagaggccccaaaccagaaatctgaagagttgagtctggacccaagt
tttggccatccacagcccccagaagtcaaagtggaggggcctaaggaagaattggaagct
gcaagggctggaggcttcagttcagaagctgtcaaagctgaaccagaagtctcaccctca
gaaggcctgctggctcggctcccagccatcctgacagagaatacagcacaggtgtgtggc
ctctccacttccaccactgagatcactcagccgcagaagggccgaaagcctcgggacctg
gaacttccacttagtccaagcctgctgggtggccagggacctgaacggactccgggatca
ggaacaagctctggtcttcaggcaccggggccagcgctaacgccatccctgctccccaca
cataccttgaccccggtgctgctgacacccagctcgctgccccctagcatccatttctgg
agcactctgagtccaattgcaccccgtagtccagccaagctctccttccagtttccgtcc
agtggcagcgcacaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtg
gtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system