KEGG   Mus caroli (Ryukyu mouse): 110286861
Entry
110286861         CDS       T05910                                 

Gene name
Ar
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04114  Oocyte meiosis
mcal05200  Pathways in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110286861 (Ar)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110286861 (Ar)
  09162 Cancer: specific types
   05215 Prostate cancer
    110286861 (Ar)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110286861 (Ar)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110286861 (Ar)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    110286861 (Ar)
Nuclear receptors [BR:mcal03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   110286861 (Ar)
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110286861
NCBI-ProteinID: XP_021009144
Ensembl: MGP_CAROLIEiJ_G0033258
UniProt: A0A6P5P536
LinkDB
Position
X
AA seq 894 aa
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREAIQNPGPRHPEAANIAPPGACLQQRQET
SPRRRRRQQHSEDGSPQAHIRGPTGYLALEEEQQPSQQQAASEGHPESSCLPEPGAATAP
GKGLPQQPPAPPDQDDSAAPSTLSLLGPTFPGLSSCSADIKDILNEAGTMQLLQQQQQQQ
QHQQHQQQQEVISEGSSVRAREATGAPSSSKDSYLGGNSTISDSAKELCKAVSVSMGLGV
EALEHLSPGEQLRGDCMYASLLGGPPAVRPTPCAPLPECKGLPLDEGPGKGTEETAEYSS
FKGSYAKGLEGESLGCSGSSEAGSSGTLEIPSSLSLYKSGAIDEAAAYQNRDYYNFPLAL
SGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCRYGDLGSLHGGSVAGPSTGSPPATT
SSSWHTLFTAEEGQLYGPGGGGGSSSPNDAGPVAPYGYTRPPQGLTSQEGDYSASEVWYP
GVVNRVPYPSPNCVKSEMGPWMENYSGPYGDMRLDSTRDHVLPIDYYFPPQKTCLICGDE
ASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMT
LGARKLKKLGNLKLQEEGENSNAGSPTEDPSQKMTVSHIEGYECQPIFLNVLEAIEPGVV
CAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLM
VFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFL
CMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDS
VQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggaggtgcagttagggctgggaagggtctacccacggcccccgtccaagacctatcga
ggagcgttccagaatctgttccagagcgtgcgtgaagcgatccagaacccgggccccagg
caccctgaggccgctaacatagcacctcccggcgcctgtttacagcagaggcaggagact
agcccccggcggcggcggcggcagcagcactctgaggatggttctcctcaagcccatatc
agaggccccacaggctacctggccctggaggaggaacagcagccttcacagcagcaggca
gcctccgagggccaccctgagagcagctgcctccccgagcctggggcggccactgctcct
ggcaaggggctgccgcaacagccaccagctcctccagatcaggatgactcagctgcccca
tccacgttgtccctgctgggccccactttcccaggcttaagcagctgctccgccgacatt
aaagacattctgaacgaggccggcaccatgcaacttcttcagcagcagcaacaacagcag
cagcaccaacagcaccaacagcagcaggaggtaatctccgaaggcagcagcgtgagagcc
agggaggccacgggggctccctcttcctccaaggatagttacctagggggcaattcaacc
atatctgacagtgccaaggagttgtgtaaagcagtgtctgtgtccatgggattgggtgtg
gaagccctggaacatttgagtccaggggaacagcttcggggagactgcatgtacgcgtcg
ctcctgggaggtccacccgcggtgcgtcccactccttgtgcgccactgcccgaatgcaaa
ggtcttcccctggacgaaggcccaggcaaaggcactgaagagactgctgagtattcctct
ttcaagggaagttacgccaaaggattggaaggtgagagcttgggctgctctggcagcagt
gaagcaggtagctctgggacactcgagatcccgtcctctctgtctctgtataaatctgga
gcaatagacgaggcagcagcataccagaatcgcgactactacaactttccgctggctctg
tccgggccgccgcaccccccgccccctacccatccacacgcccgcatcaagctggagaac
ccattggactatggcagcgcctgggctgcggcggcagcgcaatgccgctatggggacttg
ggtagtctacatggagggagtgtagccgggcccagcactggatcgcccccagccaccacc
tcttcttcctggcatactctcttcacagctgaagaaggccaattatatgggccaggaggc
gggggcggcagcagcagtccaaacgatgccgggcctgtagccccctatggctacactcgg
ccccctcaggggctgacaagccaggagggtgactactctgcctccgaagtgtggtatcct
ggtgttgtgaacagagtaccctatcccagtcccaactgtgtcaaaagtgaaatgggacct
tggatggagaactactccggaccttatggggacatgcgtttggacagtaccagggaccat
gttttacccatcgactattactttccaccccagaagacctgcctgatctgtggagatgaa
gcttctggttgtcactacggagctctcacttgtggcagctgcaaggtcttcttcaaaaga
gccgctgaagggaaacagaagtatctatgtgccagcagaaacgattgtaccattgataaa
tttcggaggaaaaattgtccatcttgtcgtctcaggaaatgttatgaagcagggatgact
ctgggagctcgtaagctgaagaaacttggaaatctaaaactacaggaggaaggagaaaac
tccaatgctggcagccccactgaggacccatcccaaaagatgactgtatcacacattgaa
ggctatgaatgtcagcctatctttcttaacgtcctggaagccattgagccaggagtggtg
tgtgccggacatgacaacaaccagccagattcctttgctgccttgctatctagcctcaat
gagcttggagagaggcagcttgtgcatgtggtcaagtgggccaaggccttgcctggcttc
cgcaacttgcatgtggatgaccagatggcagtcattcagtattcctggatgggactgatg
gtatttgctatgggttggcggtccttcactaatgtcaactccagaatgctctactttgca
cctgacttggttttcaatgagtaccgcatgcacaagtctcggatgtacagccagtgtgtg
aggatgaggcacctgtctcaagagtttggatggctccaaataaccccccaggaattcctg
tgcatgaaagcactgctgctcttcagcattattccagtggatgggctgaaaaatcaaaaa
ttctttgatgaacttcgaatgaactacatcaaggaactcgatcgcatcattgcatgcaaa
agaaagaatcccacatcctgctcaaggcgcttctaccagctcaccaagctcctggattct
gtgcagcctattgcaagagagctgcatcagttcacttttgacctgctaatcaagtcccat
atggtgagcgtggactttcctgaaatgatggcagagatcatctctgtgcaagtgcccaag
attctttctgggaaagtcaagcccatctatttccacacacagtga

DBGET integrated database retrieval system