KEGG   Mus caroli (Ryukyu mouse): 110287540
Entry
110287540         CDS       T05910                                 

Gene name
Araf
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04068  FoxO signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04650  Natural killer cell mediated cytotoxicity
mcal04720  Long-term potentiation
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110287540 (Araf)
   04012 ErbB signaling pathway
    110287540 (Araf)
   04068 FoxO signaling pathway
    110287540 (Araf)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110287540 (Araf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110287540 (Araf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110287540 (Araf)
   04914 Progesterone-mediated oocyte maturation
    110287540 (Araf)
   04928 Parathyroid hormone synthesis, secretion and action
    110287540 (Araf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110287540 (Araf)
  09156 Nervous system
   04726 Serotonergic synapse
    110287540 (Araf)
   04720 Long-term potentiation
    110287540 (Araf)
   04730 Long-term depression
    110287540 (Araf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110287540 (Araf)
   05205 Proteoglycans in cancer
    110287540 (Araf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110287540 (Araf)
   05212 Pancreatic cancer
    110287540 (Araf)
   05225 Hepatocellular carcinoma
    110287540 (Araf)
   05226 Gastric cancer
    110287540 (Araf)
   05214 Glioma
    110287540 (Araf)
   05221 Acute myeloid leukemia
    110287540 (Araf)
   05220 Chronic myeloid leukemia
    110287540 (Araf)
   05218 Melanoma
    110287540 (Araf)
   05211 Renal cell carcinoma
    110287540 (Araf)
   05219 Bladder cancer
    110287540 (Araf)
   05215 Prostate cancer
    110287540 (Araf)
   05213 Endometrial cancer
    110287540 (Araf)
   05224 Breast cancer
    110287540 (Araf)
   05223 Non-small cell lung cancer
    110287540 (Araf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110287540 (Araf)
   05022 Pathways of neurodegeneration - multiple diseases
    110287540 (Araf)
  09165 Substance dependence
   05034 Alcoholism
    110287540 (Araf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110287540 (Araf)
   05160 Hepatitis C
    110287540 (Araf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110287540 (Araf)
   01522 Endocrine resistance
    110287540 (Araf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110287540 (Araf)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110287540 (Araf)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110287540 (Araf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal TUG-UBL1 Kdo APH
Other DBs
NCBI-GeneID: 110287540
NCBI-ProteinID: XP_021009780
Ensembl: MGP_CAROLIEiJ_G0032967
UniProt: A0A6P5P4L3
LinkDB
Position
X
AA seq 643 aa
MISQCVYTSNLFVTPSSYQEAYGSCPVLPQPILKTILGNMEPPRGPPASGAEPSRAVGTV
KVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPL
DGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVP
TVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELLTPQGPSPFAQQRDQEHFSFPA
PANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFSTDAAGRGGDGAPRGSPSPASV
SSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGT
VFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQ
WCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTV
KIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELM
TGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAMRRLLTDCLKFQREERPLFPQI
LATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgatttcacagtgcgtttacaccagtaatctgtttgtgacccccagtagttatcaggag
gcctatggcagctgcccagtcctacctcagcccatcttgaaaacaatcttaggcaacatg
gaaccaccacgaggccctcctgctagtggggctgagccatctcgggcagttggcactgtc
aaggtgtacctgcctaacaagcaacgcacagtggtgactgtccgggaaggcatgagtgtc
tatgactctttggacaaggccctgaaggtgcggggtctcaatcaggactgctgcgtggtc
tacaggctcatcaaaggaagaaagacagtcactgcctgggacacagccattgcgcctctg
gatggtgaggagctcattgtggaggtcctagaagatgtgccactgaccatgcacaatttt
gtacggaagacattcttcagcctggccttctgtgacttctgccttaagtttctgttccat
ggattccgctgccagacctgtggctacaagttccaccagcattgttcctccaaggtcccc
accgtctgcgttgacatgagtaccaaccgccgacagttctaccacagcatccaggatttg
tctggaggctccaggcagcaggaggctccctcaaatctctctgtgaatgagctgctaacc
ccccagggtcccagcccctttgcccagcaacgtgaccaggagcacttctcattccctgcc
cctgccaatcccccactgcagcgcatccgttccacatctactcctaacgtccacatggtc
agcaccacagctcccatggactccagcctcatgcagtttactgctcagagcttcagcacc
gatgctgctggtagaggtggtgatggagcccctcggggtagccctagcccagctagtgtg
tcttcagggaggaagtccccacattccaagttaccttcagaacagcgggagcggaagtcc
ttggcagatgaaaagaaaaaagtgaagaacctggggtaccgggactcaggctattactgg
gaggtgccacccagtgaggtacagctgttgaagaggatcgggacaggctcttttggcact
gtgtttcgggggcgttggcatggcgatgtagctgtgaaagtgctcaaggtggcccaacct
accgctgagcaggcccaggccttcaagaatgagatgcaggtgctcagaaagacacggcat
gtcaacattttgctgttcatgggtttcatgactcggccggggtttgccatcatcacacag
tggtgtgagggttccagcctctaccaccacctccatgtggctgacacgcgctttgacatg
gtccagctcattgatgtggcccggcagactgcccagggcatggactacctccacgccaag
aacatcattcatcgagacctaaagtccaacaatatcttcttacatgaggggctcacagtc
aagattggtgacttcggcctggccacagtgaagacacggtggagtggggcacagccctta
gagcagccctcagggtctgtgctatggatggcagctgaggtgatccgtatgcaggacccg
aacccctacagcttccagtcggatgtctatgcctatggtgttgtgctctatgagcttatg
accggctcactgccctacagccacattggcagccgtgaccagatcatctttatggtgggc
cgtggctatctgtctccggacctcagcaaaatcttcagtaattgccccaaagccatgagg
cgcctgctgactgactgcctcaagttccagcgggaggagcggcccctatttccccagatt
ctggccacgatcgagctactgcagcggtcactccccaagattgagcggagtgcctccgaa
ccctccttgcaccgcacccaggctgatgagttgcctgcttgccttctcagcgcagcccgt
cttgtgccttag

KEGG   Mus caroli (Ryukyu mouse): 110295945
Entry
110295945         CDS       T05910                                 

Gene name
Braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04015  Rap1 signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04150  mTOR signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04510  Focal adhesion
mcal04650  Natural killer cell mediated cytotoxicity
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05216  Thyroid cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295945 (Braf)
   04012 ErbB signaling pathway
    110295945 (Braf)
   04015 Rap1 signaling pathway
    110295945 (Braf)
   04068 FoxO signaling pathway
    110295945 (Braf)
   04024 cAMP signaling pathway
    110295945 (Braf)
   04150 mTOR signaling pathway
    110295945 (Braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110295945 (Braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110295945 (Braf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110295945 (Braf)
   04062 Chemokine signaling pathway
    110295945 (Braf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110295945 (Braf)
   04914 Progesterone-mediated oocyte maturation
    110295945 (Braf)
   04928 Parathyroid hormone synthesis, secretion and action
    110295945 (Braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110295945 (Braf)
  09156 Nervous system
   04726 Serotonergic synapse
    110295945 (Braf)
   04720 Long-term potentiation
    110295945 (Braf)
   04730 Long-term depression
    110295945 (Braf)
   04722 Neurotrophin signaling pathway
    110295945 (Braf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110295945 (Braf)
   05205 Proteoglycans in cancer
    110295945 (Braf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110295945 (Braf)
   05212 Pancreatic cancer
    110295945 (Braf)
   05225 Hepatocellular carcinoma
    110295945 (Braf)
   05226 Gastric cancer
    110295945 (Braf)
   05214 Glioma
    110295945 (Braf)
   05216 Thyroid cancer
    110295945 (Braf)
   05221 Acute myeloid leukemia
    110295945 (Braf)
   05220 Chronic myeloid leukemia
    110295945 (Braf)
   05218 Melanoma
    110295945 (Braf)
   05211 Renal cell carcinoma
    110295945 (Braf)
   05219 Bladder cancer
    110295945 (Braf)
   05215 Prostate cancer
    110295945 (Braf)
   05213 Endometrial cancer
    110295945 (Braf)
   05224 Breast cancer
    110295945 (Braf)
   05223 Non-small cell lung cancer
    110295945 (Braf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295945 (Braf)
   05022 Pathways of neurodegeneration - multiple diseases
    110295945 (Braf)
  09165 Substance dependence
   05034 Alcoholism
    110295945 (Braf)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110295945 (Braf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110295945 (Braf)
   05160 Hepatitis C
    110295945 (Braf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110295945 (Braf)
   01522 Endocrine resistance
    110295945 (Braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110295945 (Braf)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110295945 (Braf)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110295945 (Braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 APH Kdo
Other DBs
NCBI-GeneID: 110295945
NCBI-ProteinID: XP_021020018
Ensembl: MGP_CAROLIEiJ_G0028251
LinkDB
Position
6
AA seq 764 aa
MAALSGGGGSSSGGGGGGGGGGGGGDGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAI
PEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESL
VFQTPTDVSRNNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCA
VYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLF
QGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPVPQEEASLPETALPSGS
SSAPPSDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPV
NIDEKFPEVELQDQRDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRE
RKSSSSSSSEDRSRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVK
MLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHI
IETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR
WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD
QIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
IHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2295 nt   +upstreamnt  +downstreamnt
atggcggcgctgagtggcggcggtggcagcagcagcggtggcggcggcggcggtggcggc
ggcggtggcggtggcgacggcggcggcggcgccgagcagggccaggctctgttcaatggc
gacatggagccggaggccggcgctggcgccgcggcctcttcggctgcggacccggccatt
cctgaagaggtatggaatatcaagcaaatgattaagttgacacaggaacatatagaggcc
ctattggacaaatttggtggagagcataacccaccatcaatatacctggaggcctatgaa
gagtacaccagcaagctagatgcccttcagcaaagagaacagcagcttttggaatccctg
gtttttcaaactcccacagatgtatcacggaacaaccccaagtcaccacagaaacctatc
gttagagtcttcctgcccaacaaacagagaacagtggtacctgcaagatgtggtgttaca
gttcgagacagtctaaagaaagcactgatgatgagaggtctcatcccagaatgctgtgct
gtttacagaattcaggatggagagaagaaaccaattggctgggacacggacatttcctgg
cttactggagaggagttacatgttgaagtactagagaatgttccacttacaacacacaac
tttgtacggaaaacttttttcaccttagcattttgtgacttttgccgaaagctgcttttc
cagggtttccgttgtcaaacatgtggttataaatttcaccagcgttgtagtacagaggtt
ccactgatgtgtgtaaattatgaccaacttgatttgctgtttgtctccaagttctttgag
catcacccagtaccacaggaggaggcctccttaccagagactgcccttccatctggatcc
tcttccgcacccccctcagactctattgggccccaaatcctcaccagtccatctccttca
aaatccattccaattccacagcccttccgaccagcagatgaagatcatcgcaatcagttt
gggcaacgagaccggtcctcctcagctcctaatgttcatataaacacaattgagcctgtc
aatatcgatgaaaaattcccagaagtggaattacaggatcaaagggatttgattagagac
caggggtttcgtggtgatggagggtcaaccacaggcttgtccgccaccccgcctgcctca
ttacctggctcactcactaacgtgaaagccttacagaaatctccaggtcctcagcgggaa
aggaagtcgtcttcttcctcatcctcggaggacagaagtcggatgaaaacacttggtaga
agagattcaagtgatgactgggagattcctgatggacagattacagtgggacagagaatt
ggatctgggtcatttggaactgtctacaagggaaagtggcatggtgatgtggcagtgaaa
atgttgaatgtgacagcacccacacctcaacagttacaggccttcaaaaatgaagtagga
gtactcaggaaaactcgacatgtgaacatcctccttttcatgggctattctacaaagcca
caactggcaattgttacacagtggtgtgagggctccagcttatatcaccatctccacatc
attgagaccaaatttgagatgatcaaacttatagatattgctcggcagactgcacagggc
atggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatattt
cttcatgaagacctcacggtaaaaataggtgactttggtctagccacagtgaaatctcgg
tggagtgggtcccatcagtttgaacagttgtctggatctattttgtggatggcaccagaa
gtaatcagaatgcaagataagaacccgtatagctttcagtcagatgtgtatgcattcggg
attgtgctgtatgaactgatgactggccagctaccttattcaaacatcaacaacagggac
cagataatttttatggtgggacgaggatacctatccccagatctcagtaaggtacggagt
aactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagacgag
agaccactctttccccaaattctcgcctccattgagctgctggcccgctcattgccaaaa
attcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaagatttt
agtctgtatgcttgtgcttctccgaaaacacccatccaagcagggggatatggagaattt
gcagccttcaagtag

KEGG   Mus caroli (Ryukyu mouse): 110296919
Entry
110296919         CDS       T05910                                 

Gene name
Raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04218  Cellular senescence
mcal04270  Vascular smooth muscle contraction
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04371  Apelin signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04613  Neutrophil extracellular trap formation
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04720  Long-term potentiation
mcal04722  Neurotrophin signaling pathway
mcal04726  Serotonergic synapse
mcal04730  Long-term depression
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04929  GnRH secretion
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05034  Alcoholism
mcal05132  Salmonella infection
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110296919 (Raf1)
   04012 ErbB signaling pathway
    110296919 (Raf1)
   04014 Ras signaling pathway
    110296919 (Raf1)
   04015 Rap1 signaling pathway
    110296919 (Raf1)
   04370 VEGF signaling pathway
    110296919 (Raf1)
   04371 Apelin signaling pathway
    110296919 (Raf1)
   04630 JAK-STAT signaling pathway
    110296919 (Raf1)
   04068 FoxO signaling pathway
    110296919 (Raf1)
   04072 Phospholipase D signaling pathway
    110296919 (Raf1)
   04071 Sphingolipid signaling pathway
    110296919 (Raf1)
   04024 cAMP signaling pathway
    110296919 (Raf1)
   04022 cGMP-PKG signaling pathway
    110296919 (Raf1)
   04151 PI3K-Akt signaling pathway
    110296919 (Raf1)
   04150 mTOR signaling pathway
    110296919 (Raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110296919 (Raf1)
  09143 Cell growth and death
   04210 Apoptosis
    110296919 (Raf1)
   04218 Cellular senescence
    110296919 (Raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110296919 (Raf1)
   04540 Gap junction
    110296919 (Raf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110296919 (Raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110296919 (Raf1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110296919 (Raf1)
   04625 C-type lectin receptor signaling pathway
    110296919 (Raf1)
   04650 Natural killer cell mediated cytotoxicity
    110296919 (Raf1)
   04660 T cell receptor signaling pathway
    110296919 (Raf1)
   04662 B cell receptor signaling pathway
    110296919 (Raf1)
   04664 Fc epsilon RI signaling pathway
    110296919 (Raf1)
   04666 Fc gamma R-mediated phagocytosis
    110296919 (Raf1)
   04062 Chemokine signaling pathway
    110296919 (Raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110296919 (Raf1)
   04929 GnRH secretion
    110296919 (Raf1)
   04912 GnRH signaling pathway
    110296919 (Raf1)
   04915 Estrogen signaling pathway
    110296919 (Raf1)
   04914 Progesterone-mediated oocyte maturation
    110296919 (Raf1)
   04917 Prolactin signaling pathway
    110296919 (Raf1)
   04921 Oxytocin signaling pathway
    110296919 (Raf1)
   04926 Relaxin signaling pathway
    110296919 (Raf1)
   04935 Growth hormone synthesis, secretion and action
    110296919 (Raf1)
   04919 Thyroid hormone signaling pathway
    110296919 (Raf1)
   04928 Parathyroid hormone synthesis, secretion and action
    110296919 (Raf1)
   04916 Melanogenesis
    110296919 (Raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110296919 (Raf1)
  09156 Nervous system
   04726 Serotonergic synapse
    110296919 (Raf1)
   04720 Long-term potentiation
    110296919 (Raf1)
   04730 Long-term depression
    110296919 (Raf1)
   04722 Neurotrophin signaling pathway
    110296919 (Raf1)
  09158 Development and regeneration
   04360 Axon guidance
    110296919 (Raf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296919 (Raf1)
   05206 MicroRNAs in cancer
    110296919 (Raf1)
   05205 Proteoglycans in cancer
    110296919 (Raf1)
   05230 Central carbon metabolism in cancer
    110296919 (Raf1)
   05231 Choline metabolism in cancer
    110296919 (Raf1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110296919 (Raf1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110296919 (Raf1)
   05212 Pancreatic cancer
    110296919 (Raf1)
   05225 Hepatocellular carcinoma
    110296919 (Raf1)
   05226 Gastric cancer
    110296919 (Raf1)
   05214 Glioma
    110296919 (Raf1)
   05221 Acute myeloid leukemia
    110296919 (Raf1)
   05220 Chronic myeloid leukemia
    110296919 (Raf1)
   05218 Melanoma
    110296919 (Raf1)
   05211 Renal cell carcinoma
    110296919 (Raf1)
   05219 Bladder cancer
    110296919 (Raf1)
   05215 Prostate cancer
    110296919 (Raf1)
   05213 Endometrial cancer
    110296919 (Raf1)
   05224 Breast cancer
    110296919 (Raf1)
   05223 Non-small cell lung cancer
    110296919 (Raf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110296919 (Raf1)
   05022 Pathways of neurodegeneration - multiple diseases
    110296919 (Raf1)
  09165 Substance dependence
   05034 Alcoholism
    110296919 (Raf1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110296919 (Raf1)
   05152 Tuberculosis
    110296919 (Raf1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110296919 (Raf1)
   05161 Hepatitis B
    110296919 (Raf1)
   05160 Hepatitis C
    110296919 (Raf1)
   05164 Influenza A
    110296919 (Raf1)
   05163 Human cytomegalovirus infection
    110296919 (Raf1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110296919 (Raf1)
   05165 Human papillomavirus infection
    110296919 (Raf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110296919 (Raf1)
   01522 Endocrine resistance
    110296919 (Raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110296919 (Raf1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110296919 (Raf1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110296919 (Raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 110296919
NCBI-ProteinID: XP_021021383
Ensembl: MGP_CAROLIEiJ_G0028755
UniProt: A0A6P5PZJ3
LinkDB
Position
6
AA seq 648 aa
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPAPPSFPMRRMRESVSRMPASSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLHVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYAHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaacggctttggactcaaagatgcg
gtgtttgatggctccagctgcatctcccctaccattgttcagcagtttggctatcagcgc
cgggcctcagatgatggcaaactcacggattcttctaagacaagcaatactatccgggtt
ttcttgccgaataagcaaaggactgtggtcaatgtgcggaatggaatgagcttgcatgac
tgccttatgaaagctctgaaggtgagaggcctgcagccagaatgctgtgcagtgttcaga
cttctccaggaacacaaaggtaagaaagcacgcttagattggaacaccgatgctgcctct
ctgattggagaagaactgcaagtggattttttggatcatgttccactcacaactcacaac
tttgctcggaaaacgttcctgaagcttgcattctgtgacatctgtcagaagttcctgcta
aatggatttcgatgtcagacttgtggctacaagtttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctcttgctgtttccaaattccact
gttggtgacagtggagtcccagcaccaccttctttcccaatgcgccggatgcgagaatct
gtttcccggatgcctgctagttcccagcacagatactccacaccccacgccttcactttc
aacacctccagcccttcctcagaaggttccctgtcccagaggcagaggtcaacgtccact
cccaatgtccacatggtcagcaccaccctgcatgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcagcctcaccttcagccctgtccagcagcccaaacaacctg
agtccaacaggctggtcacagcccaaaacccctgtgccagcacaaagagagcgggcacca
ggatctgggacccaggaaaaaaacaaaattaggcctcgtgggcagagagattcaagttat
tactgggaaatagaagccagtgaggtgatgctgtctactcggatcgggtcaggttccttt
ggcactgtgtacaagggcaagtggcatggagatgttgcagtaaagatcctaaaggtggtt
gacccaactccagagcaactccaggccttcaggaacgaggtggctgttttgcgcaaaaca
cggcatgttaacatcctgctgttcatggggtacatgacaaaggacaacctggcgattgtg
acccagtggtgtgagggcagcagtctctacaaacacctgcatgtccaggagaccaaattc
cagatgttccagctaattgacattgcccgacagacagctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctc
acggtgaaaattggagattttggtttggcaacagtgaagtcacgctggagtggttctcag
caggttgaacagcccactggctctgtgctgtggatggccccagaagtaatccggatgcag
gataacaacccgttcagcttccaatccgacgtctactcctatggcatcgtgctgtacgag
ctgatgactggggagcttccctacgcccacatcaacaaccgagaccagatcatcttcatg
gtaggccgtgggtatgcatccccagatctcagcaggctctacaagaactgccccaaggca
atgaagaggttggtggctgactgtgtgaagaaagtcaaagaagagagacctttgtttccc
cagatcctgtcttccatagagctgcttcagcactctctgccgaaaatcaacaggagcgcc
tctgagccttccctgcatcgggcagctcacactgaggacatcaatgcttgcacgctgact
acatccccaaggctaccagtcttctag

DBGET integrated database retrieval system