KEGG   Mus caroli (Ryukyu mouse): 110288090
Entry
110288090         CDS       T05910                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00590  Arachidonic acid metabolism
mcal01100  Metabolic pathways
mcal04064  NF-kappa B signaling pathway
mcal04370  VEGF signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04726  Serotonergic synapse
mcal04913  Ovarian steroidogenesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05140  Leishmaniasis
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110288090
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110288090
   04064 NF-kappa B signaling pathway
    110288090
   04668 TNF signaling pathway
    110288090
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110288090
   04657 IL-17 signaling pathway
    110288090
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110288090
   04913 Ovarian steroidogenesis
    110288090
   04921 Oxytocin signaling pathway
    110288090
  09156 Nervous system
   04726 Serotonergic synapse
    110288090
   04723 Retrograde endocannabinoid signaling
    110288090
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110288090
   05206 MicroRNAs in cancer
    110288090
   05204 Chemical carcinogenesis
    110288090
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110288090
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110288090
   05022 Pathways of neurodegeneration - multiple diseases
    110288090
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110288090
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288090
   05165 Human papillomavirus infection
    110288090
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110288090
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110288090
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 110288090
NCBI-ProteinID: XP_021010197
UniProt: A0A6P5P7T9
LinkDB
Position
Unknown
AA seq 564 aa
MLFQAVLHCAALGLSHAANPCCPNSFQNHSECMSIGFDQYKCDCTXTAFYGENCTTPEFQ
TRIELLLKPTPNTVHYTLSLFKGVWNIVNNIRFLRSSVMRYVLRWRSHLIDSLPTYHMHR
GYKSWEAFSNLSYYTRSFPPVADDCPTPMGVKGNKELPDSKEVLEKVLLQREFIPDPQGS
NMMFAFFAQHFTHQFFKTNQKQXPGFTRGLGHGVDLNHIYSVTLDRKHKLCLFKDGKLKY
QIIGGEVYPPTVKDTQVEMIYPPCIPENLQFALGQEVFGLVPGLLMYTTIWLWEHNRVCD
ILKQEHPEWEDERLFQISRLILIGETSKIVMEDYMQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWQPLLPHTFNTEDQEYSFNQFLYNNSILLKGGFTQFFESFTRQIAGRV
PGGRNVLIALQAVAKASIDQSRQMKYQSLNEYRKRFSLKPYTSSEELTGEKEMAAELKAL
FSAIDAIELYPALLAGKPCPDAIFGKTMVELGAPFSLKGLRGNPVGSPQYLKLSTFSGEV
SFKIINTASIQSLICKNVKGFPFL
NT seq 1691 nt   +upstreamnt  +downstreamnt
atgctcttccaagctgtgctgcactgtgctgccctggggctcagccatgctgcaaatcct
tgctgtcccaactcatttcaaaaccacagtgaatgtatgagcataggatttgatcagtat
aagtgtgactgcactngtactgcattctatggtgaaaactgtactacacctgaatttcag
acaagaattgagttactgctgaagcccaccccaaacacagtgcactacaccctgagcctc
ttcaagggagtctggaacattgtgaacaacattcgcttcctgcgaagttcagtcatgaga
tatgtgctgagatggagatcacatttgattgacagtctaccaacgtaccacatgcaccgt
ggttacaaaagctgggaagccttctccaacctctcctactacaccaggtcctttcctcca
gtagcagatgactgcccaactcccatgggtgtgaagggaaataaggagcttcctgattca
aaagaagtgctggaaaaggttcttcttcagagagagttcattcctgacccccaaggctca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacaaatcag
aagcaangaccagggttcacccgaggactggggcatggagtagacttaaatcacatttat
agtgtaactctagacagaaaacataaactatgccttttcaaggatggaaaattgaaatat
cagatcattggtggagaggtgtatcctcccacagtcaaagatactcaggtagagatgatc
taccctccttgcatccctgagaacctgcagtttgctctggggcaggaagtctttggtctg
gtgcctggtctgctgatgtatacaaccatctggctttgggagcacaacagagtgtgtgac
atactcaaacaggagcatcctgagtgggaggatgagcgactattccaaatcagcagactc
atactcataggagagactagcaagatagtgatggaagactacatgcaacacctgagtggt
taccacttcaaactcaagtttgacccagagctccttttcaaccagcagttccagtatcag
aatcgcattgcctctgaattcaacacactctatcactggcaacccctgctgccccatacc
ttcaacactgaggaccaggaatacagcttcaatcagtttctctacaacaactccatcctc
ctcaaaggaggatttactcagttttttgagtcattcaccagacagattgctggccgggtt
cctgggggaagaaatgttctaattgccctacaagcagtggcaaaggcctccattgaccag
agcagacagatgaaataccagtctctcaatgagtaccgcaaacgcttctccctgaagcct
tacacatcatctgaagaacttacaggagaaaaggaaatggctgcagagttgaaagctctc
ttcagtgccatcgatgccatagaactgtatcctgccctgctggcaggaaagccttgtcca
gatgctatctttgggaagaccatggtagaacttggagcaccattctccttgaaaggactt
aggggtaatcccgtcggttctccccagtacctgaagctgagcaccttcagtggagaagtg
agttttaagatcatcaatactgcctcaattcagtctctcatctgcaaaaatgtgaagggg
tttccctttct

KEGG   Mus caroli (Ryukyu mouse): 110288092
Entry
110288092         CDS       T05910                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00590  Arachidonic acid metabolism
mcal01100  Metabolic pathways
mcal04064  NF-kappa B signaling pathway
mcal04370  VEGF signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04726  Serotonergic synapse
mcal04913  Ovarian steroidogenesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05140  Leishmaniasis
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110288092
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110288092
   04064 NF-kappa B signaling pathway
    110288092
   04668 TNF signaling pathway
    110288092
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110288092
   04657 IL-17 signaling pathway
    110288092
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110288092
   04913 Ovarian steroidogenesis
    110288092
   04921 Oxytocin signaling pathway
    110288092
  09156 Nervous system
   04726 Serotonergic synapse
    110288092
   04723 Retrograde endocannabinoid signaling
    110288092
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110288092
   05206 MicroRNAs in cancer
    110288092
   05204 Chemical carcinogenesis
    110288092
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110288092
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110288092
   05022 Pathways of neurodegeneration - multiple diseases
    110288092
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110288092
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288092
   05165 Human papillomavirus infection
    110288092
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110288092
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110288092
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 110288092
NCBI-ProteinID: XP_021010199
UniProt: A0A6P5P7M8
LinkDB
Position
Unknown
AA seq 546 aa
MLFRAVLLCAALALSHVANPCCSNPCQNRGEYMSIGFDQCKCDCTWTGFCGENCTIREFL
TRIELLMKPTPNTVHYILSLFKGVWNIVNNIRFLRSSVMKYVLTSKSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRVLPPVADDSRTPKGVKGNKELPDSKEVLEKVLLRREIMPDPQGS
NMMFAFFAQHFTHQFFKTDQKQGPGITRGLGHGVDLNHIYGKTLERQHNLCIFKDEKLKY
QIFSLCGEVNPPTVKDTQVEMIDPPQIPKNLQFAVGHEVFGLVPGVIMDATIWLWEHNRV
CDILKQEHPMWEDEPLFQTRRLIGKTMKIAIEDYVQHLNSSDFKLKFDPELLFNQQLHYQ
NLTASAFNTLYHWQPLLPDTFNTKVQEYSFKQSLYNSILLEQGLTQIVQSFTRQIAGRVS
IVPEKQEPADQSIEMKYQSLKQKPYTSFKELTGEKEIAAGLKSLFTGLDTIELYPGLLVE
KPCPDAIFGDTLVELETPFFLKGFRGNPIYSPQYWKPSTFSGVVRFKIINTTLTQSLILK
NVKGCP
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgctctttagagctgtgctgctctgtgccgccctggcactcagccatgtagcaaatcct
tgctgttccaatccatgtcaaaaccgcggggaatatatgagcataggatttgaccagtgt
aagtgtgactgtacctggactggattctgcggtgaaaactgtactatacgtgaatttctg
acaagaattgagttactgatgaagcccaccccaaacacagtgcactacatcctgagcctc
ttcaagggagtctggaacattgtgaacaacattcgcttcctgcgaagttcagtcatgaaa
tatgtgctgacatccaaatcacatttgattgacagtccaccaacttacaatgtgcactat
ggttacaaaagctgggaagccttctccaacctatcctactacaccagggtccttcctcca
gtagcagatgacagcagaactccaaagggtgtgaagggaaataaggagcttcctgattca
aaagaagtgctggaaaaggttcttctacggagagagatcatgcctgacccccaaggctca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcag
aagcaaggaccggggatcacccgaggactgggccatggagtggacttaaatcacatttat
ggtaaaactctggaaagacaacataatctgtgcattttcaaggatgaaaaattgaaatat
cagatattttccttatgtggagaggtgaatcctcccactgtcaaagacactcaggtagag
atgatagaccctcctcagatccctaagaacctgcagtttgctgtggggcatgaagtcttt
ggtctggtgcctggtgtgataatggatgctacaatttggctttgggagcacaacagagtg
tgtgacattctcaaacaggagcatcctatgtgggaggatgagccactattccaaacccgg
agactcataggaaaaactatgaagatagcaatcgaagactacgtgcaacacctgaacagt
tctgacttcaaactcaagtttgacccagagctccttttcaaccaacagttgcattatcag
aacctcactgcctctgcattcaacacactctatcactggcaacccctgctgcctgacact
ttcaacactaaagtccaggagtacagcttcaaacagtctctctacaactccatcctcctg
gaacagggactcactcagattgttcagtcattcaccagacagattgctggccgggtaagc
attgttcctgaaaagcaagaaccagctgaccagagcatagagatgaaataccagtctctc
aaacagaagccttatacatcatttaaagagcttacaggagagaaggaaatagctgcaggg
ttgaaatccctcttcactggccttgacaccattgaactctatcctggcctcctggtggaa
aagccctgtccagatgctatctttggggacactttggtagaacttgaaacaccattcttc
ttgaaaggatttaggggtaatcccatctattctcctcaatactggaagccgagcaccttc
agtggagtagttcgttttaagatcatcaacactaccttaactcagtctctcatcctcaaa
aatgtgaagggttgtccc

KEGG   Mus caroli (Ryukyu mouse): 110288093
Entry
110288093         CDS       T05910                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00590  Arachidonic acid metabolism
mcal01100  Metabolic pathways
mcal04064  NF-kappa B signaling pathway
mcal04370  VEGF signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04726  Serotonergic synapse
mcal04913  Ovarian steroidogenesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05140  Leishmaniasis
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110288093
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110288093
   04064 NF-kappa B signaling pathway
    110288093
   04668 TNF signaling pathway
    110288093
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110288093
   04657 IL-17 signaling pathway
    110288093
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110288093
   04913 Ovarian steroidogenesis
    110288093
   04921 Oxytocin signaling pathway
    110288093
  09156 Nervous system
   04726 Serotonergic synapse
    110288093
   04723 Retrograde endocannabinoid signaling
    110288093
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110288093
   05206 MicroRNAs in cancer
    110288093
   05204 Chemical carcinogenesis
    110288093
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110288093
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110288093
   05022 Pathways of neurodegeneration - multiple diseases
    110288093
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110288093
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288093
   05165 Human papillomavirus infection
    110288093
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110288093
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110288093
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 110288093
NCBI-ProteinID: XP_021010200
UniProt: A0A6P5P263
LinkDB
Position
Unknown
AA seq 445 aa
MALVSIIGGEVYPLRVRDTQVDTQFAVGPEVFGLVPGLLMYATIWFWEHKRVCDILKQEH
LEWEDERLFQTSRLILIGETSKIVIKDYLQHLTSYHFKLLFDPELLFNLQLHYHNCIASE
FNTLYHWHPLLPHNFKVPGGRNLLITLKAVAKSSIDQTIEVKYQSLTEYCKHFSLTPYTA
FEELPGEKEMAAELKALSSGFDVMELYPNLVVEKPHQHAIFRETMVEPGLQFPLRGLMGN
SICSLQYWKTSTFGGKVGFKIINTDSIHSLLYKPVKELPVRQLLECPPPPLPPPPPPPGL
LVPLSPDRSGLDPPLRSPRRAHPHPRRKEKERTNAKSGRDYAGDNRALKRKGRADPGGKE
GFSMGVGGDGGARPALLQSPARSTQPSEPIPIPKLRFRLADLPNLHCSNMSEALHPGVLL
QTWVRPGARSTPSPQNFQVPARAHL
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcgctggtttcaatcatcggtggagaggtgtatcctctcagagtcagagacactcag
gtcgatactcagtttgctgtgggcccagaagtctttggtctggtgcctggtctgctgatg
tatgctaccatctggttttgggagcacaagagagtgtgtgacatactcaaacaggagcat
cttgagtgggaggatgagcgactattccaaaccagcagactcatactcataggagagact
agtaagatagtgatcaaagactacttgcaacacctgaccagttaccacttcaaactcttg
tttgacccagagctccttttcaacctacagttgcattatcacaactgcattgcctctgaa
ttcaacacactctatcactggcaccccttgctgccccacaacttcaaggttcctggggga
agaaatcttctaattaccctaaaagcagtggcaaagtcctccattgaccagaccatagag
gtgaaataccagtctctcactgagtactgcaaacatttttccctgacgccttacacagca
tttgaagaacttccaggagagaaggaaatggctgcagagttgaaagccctctccagtggc
tttgatgtcatggaactgtatcccaacctggtggtggaaaagcctcaccaacatgctatc
tttagggagaccatggtagaacctggattacaattccccttgagaggccttatgggtaat
tccatctgttctcttcaatactggaaaacgagcacctttggaggaaaagtgggttttaag
attatcaacactgactcaattcattctctcctctacaaacctgtgaaggagttgccagtg
cggcagctcctggagtgtccaccgccaccactaccgccccccccacccccacccgggcta
ctggttcctctatctccggaccgcagcgggttggacccgccgctccggagcccccgccgc
gctcacccccatccccgccgcaaggagaaggaacggacaaatgcgaaaagtggacgcgac
tacgcgggggacaacagggccctgaagagaaaggggagggctgaccctggaggaaaggag
ggtttttccatgggtgtgggaggggacggcggagcacgcccagccctgcttcagtcccca
gctagatcgacacagccctcagaaccaatccccatcccgaagctaagattccggcttgcc
gacctccccaacctacattgttccaatatgtcagaggctcttcaccctggagtcctgctg
cagacctgggtaaggccaggcgcgagatccacaccctctccccagaattttcaagtgcca
gcaagagctcacctgtaa

KEGG   Mus caroli (Ryukyu mouse): 110292340
Entry
110292340         CDS       T05910                                 

Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00590  Arachidonic acid metabolism
mcal01100  Metabolic pathways
mcal04064  NF-kappa B signaling pathway
mcal04370  VEGF signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04726  Serotonergic synapse
mcal04913  Ovarian steroidogenesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05140  Leishmaniasis
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110292340
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110292340
   04064 NF-kappa B signaling pathway
    110292340
   04668 TNF signaling pathway
    110292340
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110292340
   04657 IL-17 signaling pathway
    110292340
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110292340
   04913 Ovarian steroidogenesis
    110292340
   04921 Oxytocin signaling pathway
    110292340
  09156 Nervous system
   04726 Serotonergic synapse
    110292340
   04723 Retrograde endocannabinoid signaling
    110292340
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292340
   05206 MicroRNAs in cancer
    110292340
   05204 Chemical carcinogenesis
    110292340
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110292340
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110292340
   05022 Pathways of neurodegeneration - multiple diseases
    110292340
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110292340
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292340
   05165 Human papillomavirus infection
    110292340
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110292340
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110292340
SSDB
Motif
Pfam: An_peroxidase EGF
Other DBs
NCBI-GeneID: 110292340
NCBI-ProteinID: XP_021015292
Ensembl: MGP_CAROLIEiJ_G0014685
UniProt: A0A6P5PHS6
LinkDB
Position
1
AA seq 604 aa
MLFRAVLLCATLALSQAANPCCSNPCQNRGECMSIGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLMLKPTPNTVHYILTHFKGVWNIVNNIPFLRSSVMKYVLTSRTHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRILPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGS
NMMFAFFAQHFTHQFFKTDQKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWEDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSRQMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELEAL
YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgctcttccgagctgtgctgctctgcgctactctggcgctcagccaggcagcaaatcct
tgctgttccaatccatgtcaaaaccgcggagaatgtatgagcataggatttgatcagtat
aagtgtgactgtacccggactggattctatggtgaaaactgtactacacctgaatttctg
acaagaatcaaattaatgctgaagcccaccccaaacacagtgcactacatcctgacccac
ttcaagggagtctggaatattgtgaacaacattcccttcctgcgaagttcagtcatgaaa
tatgtgctgacatccagaacacacttgattgacagtccacctacttacaatgtgcactat
ggttacaaaagctgggaagccttttccaacctctcctactacaccaggatccttcctcca
gtagcagatgactgcccaactcccatgggtgtgaagggaaataaggagcttcctgattca
aaagaagtgctggaaaaggttcttctaaggagagagttcattcctgacccccaaggctca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcag
aagcgaggacccgggttcacccgaggcctgggccatggagtggacttaaatcacatttat
ggtgaaactctggacagacaacataaactgcgccttttcaaggatggaaaattgaaatat
caggtcattggtggagaggtgtatcctcctacagtcaaagacactcaggtagagatgatc
taccctcctcacatccctgagaacctacagtttgctgtggggcaggaagtctttggtctg
gtgcctggtctgatgatgtatgccaccatctggcttcgggagcacaacagagtgtgtgac
atactcaagcaggagcatcctgagtgggaggatgagcgactattccaaaccagcagactc
atactcataggagagactatcaagatagtgatcgaagactacgtgcaacacctgagcggt
taccacttcaaactcaagtttgacccagagctccttttcaaccagcaattccagtatcag
aaccgaattgcctctgaattcaacacactctatcactggcaccccctgctgcctgacacc
ttcaacattgaagaccaggagtatagcttcaaacagtttctctacaacaactccatcctc
ctggaacacggactcactcagtttgttgagtcattcaccagacagattgctggccgggtt
gctgggggaagaaatgtgccaattgctgtacaagcagtggcaaaggcctccattgaccag
agcagacagatgaaataccagtctctcaatgagtaccgcaaacgcttctccctgaagcct
tacacatcatttgaagaacttacaggagagaaggaaatggctgcagagttggaagccctc
tacagtgacatcgatgtcatggaactgtatcctgccctgctggtggaaaaacctcgtcca
gatgctatctttggggagaccatggtagaacttggagcaccattctccttgaaaggactt
atgggaaatcccatctgttctcctcaatactggaagcctagcacctttggaggtgaagtg
ggttttaagatcatcaatactgcctcaattcagtctctcatctgcaataatgtgaagggg
tgtcccttcacttctttcaatgtgcaagatccacagcctaccaaaacagccaccatcaat
gcaagtgcctcccactccagactagatgacattaaccctacagtgctaatcaaaagacgt
tcaactgagctgtaa

DBGET integrated database retrieval system