KEGG   Mus caroli (Ryukyu mouse): 110288626
Entry
110288626         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-7
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110288626
   04151 PI3K-Akt signaling pathway
    110288626
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110288626
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110288626
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110288626
   04621 NOD-like receptor signaling pathway
    110288626
   04622 RIG-I-like receptor signaling pathway
    110288626
   04623 Cytosolic DNA-sensing pathway
    110288626
   04650 Natural killer cell mediated cytotoxicity
    110288626
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110288626
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288626
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110288626
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110288626
   05161 Hepatitis B
    110288626
   05160 Hepatitis C
    110288626
   05171 Coronavirus disease - COVID-19
    110288626
   05164 Influenza A
    110288626
   05162 Measles
    110288626
   05168 Herpes simplex virus 1 infection
    110288626
   05163 Human cytomegalovirus infection
    110288626
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288626
   05169 Epstein-Barr virus infection
    110288626
   05165 Human papillomavirus infection
    110288626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110288626
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110288626
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110288626
NCBI-ProteinID: XP_021010580
UniProt: A0A6P5P6R9
LinkDB
Position
Unknown
AA seq 190 aa
MARLCAFLIVLAVMSYWPTCCLGCDLPQTHNLRNKRTLTLLVKMRRLSPLSCLKDRKDFG
IPQEKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSVAWNATLLDSFCNDLHQQLSDLQ
GCLMQEVGVQEPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
LLARLGEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctaatagtcctggcggtgatgagctactggccaacctgt
tgtctaggatgtgaccttcctcagactcataacctcaggaacaagagaaccttgacactc
ctggtaaaaatgaggagactctctcctctctcctgcctgaaggacagaaaggactttgga
atcccacaggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg
agtgagctgacccaacagatcctgaacatcttcacatcaaaggactcatctgttgcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcagctcagtgacctgcaa
ggctgtctgatgcaggaggtaggggtacaggaacctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctctcttcctcagccaac
ttgctggcaagattgggtgaggagaaggagtga

KEGG   Mus caroli (Ryukyu mouse): 110288627
Entry
110288627         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-4
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110288627
   04151 PI3K-Akt signaling pathway
    110288627
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110288627
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110288627
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110288627
   04621 NOD-like receptor signaling pathway
    110288627
   04622 RIG-I-like receptor signaling pathway
    110288627
   04623 Cytosolic DNA-sensing pathway
    110288627
   04650 Natural killer cell mediated cytotoxicity
    110288627
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110288627
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288627
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110288627
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110288627
   05161 Hepatitis B
    110288627
   05160 Hepatitis C
    110288627
   05171 Coronavirus disease - COVID-19
    110288627
   05164 Influenza A
    110288627
   05162 Measles
    110288627
   05168 Herpes simplex virus 1 infection
    110288627
   05163 Human cytomegalovirus infection
    110288627
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288627
   05169 Epstein-Barr virus infection
    110288627
   05165 Human papillomavirus infection
    110288627
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110288627
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110288627
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110288627
NCBI-ProteinID: XP_021010581
UniProt: A0A6P5P8S9
LinkDB
Position
Unknown
AA seq 190 aa
MARLCAFLMILIVMSYWSTCSLGCDLPHTYNLRNKRALTLLEEMRRLPPLSCLKDRKDFG
FPLEKVDTQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLK
ACVMQEVGVQEPPLTQEDSLLAVRKYFHRISVYLRKKKHSLCAWEVVRAEVWRALSSSTN
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcctgatagtgatgagctactggtcaacctgt
tctctaggatgcgacctgcctcacacttataacctcaggaacaagagggccttgacactc
ctggaagaaatgagaagactcccccctctttcctgcctgaaggacaggaaggattttgga
ttccccttggagaaggtggatacccaacagatccagaaggctcaagccatccttgtgcta
agagatcttacccagcagatcttgaacctcttcacatcaaaagacttgtctgctacttgg
aatgcaactctcctagactcattctgcaatgacctccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaggaggtgggggtacaggaacctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatctctgtgtacctgagaaagaagaaacacagc
ctctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcaaccaac
ttgctggcaagattgagtgaggagaaggagtga

KEGG   Mus caroli (Ryukyu mouse): 110288628
Entry
110288628         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-5-like
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110288628
   04151 PI3K-Akt signaling pathway
    110288628
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110288628
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110288628
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110288628
   04621 NOD-like receptor signaling pathway
    110288628
   04622 RIG-I-like receptor signaling pathway
    110288628
   04623 Cytosolic DNA-sensing pathway
    110288628
   04650 Natural killer cell mediated cytotoxicity
    110288628
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110288628
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110288628
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110288628
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110288628
   05161 Hepatitis B
    110288628
   05160 Hepatitis C
    110288628
   05171 Coronavirus disease - COVID-19
    110288628
   05164 Influenza A
    110288628
   05162 Measles
    110288628
   05168 Herpes simplex virus 1 infection
    110288628
   05163 Human cytomegalovirus infection
    110288628
   05167 Kaposi sarcoma-associated herpesvirus infection
    110288628
   05169 Epstein-Barr virus infection
    110288628
   05165 Human papillomavirus infection
    110288628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110288628
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110288628
SSDB
Motif
Pfam: Interferon RIX1 APC1_C
Other DBs
NCBI-GeneID: 110288628
NCBI-ProteinID: XP_021010582
UniProt: A0A6P5P8Q7
LinkDB
Position
Unknown
AA seq 189 aa
MARLCALLMVLMVLSYWSTCSLGCDLLQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQKAQAIPVLSELTQQILTLFSSKNSSAAWDATLLDSFCNDLHQQFNDLK
ACLMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
LLASLSEKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctctcctgatggtcctgatggtgttgagctactggtctacctgc
tctctaggatgtgatctccttcagactcataacctcaggaacaagagagccttgacactc
ctggtaaaaatgaggagactctcccctctctcctgcctgaaggaccggaaggactttgga
ttcccccaggagaaggtggatgcccagcagatccagaaggctcaagccatccctgtcctg
agtgagctgacccaacagatcctgaccctcttctcatcaaagaactcatctgctgcttgg
gatgcaaccctcctagactcattctgcaatgacctccatcagcagttcaatgacctcaaa
gcctgtctgatgcaacaggtcggggtgcaggaatcccccctgacccaggaagactccctg
ctggctgtgaggaaatacttccataggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaac
ttgctggcaagcctgagtgagaaggagtga

KEGG   Mus caroli (Ryukyu mouse): 110292605
Entry
110292605         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-11
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110292605
   04151 PI3K-Akt signaling pathway
    110292605
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292605
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110292605
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110292605
   04621 NOD-like receptor signaling pathway
    110292605
   04622 RIG-I-like receptor signaling pathway
    110292605
   04623 Cytosolic DNA-sensing pathway
    110292605
   04650 Natural killer cell mediated cytotoxicity
    110292605
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292605
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110292605
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292605
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110292605
   05161 Hepatitis B
    110292605
   05160 Hepatitis C
    110292605
   05171 Coronavirus disease - COVID-19
    110292605
   05164 Influenza A
    110292605
   05162 Measles
    110292605
   05168 Herpes simplex virus 1 infection
    110292605
   05163 Human cytomegalovirus infection
    110292605
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292605
   05169 Epstein-Barr virus infection
    110292605
   05165 Human papillomavirus infection
    110292605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110292605
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110292605
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110292605
NCBI-ProteinID: XP_021015689
UniProt: A0A6P5PDY8
LinkDB
Position
4
AA seq 190 aa
MARLCAFLMILIVMSHWSTCSLGCDLPHTYNLRNKRALKVLAQMRRIPPLSCLKDRKDFG
FPLEKVDNQQIQKAQAIPVLRDLSQQILNLFTSKASSAAWNATLLDSFCNDVHQQLNDLQ
GCLMQEVGVQELPLAQEDSLLAVRTYFHRITVYLREKKHSLCAWEVVRAEVWRALSSSVN
LLARLSEEKA
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcctgatagtgatgagccactggtcaacctgt
tctctaggatgtgacctgcctcacacttataacctcaggaacaagagggccttgaaggtt
ctggcacagatgaggaggatcccccctctttcctgcctgaaggacaggaaggactttgga
ttccccttggagaaggtggataaccagcagatccagaaggctcaagccatccctgtgctg
cgagatctttctcagcagatcttgaacctcttcacatcaaaggcttcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgatgtccatcagcagctcaatgacctgcaa
ggctgtctgatgcaggaggtgggggtgcaggaacttcccctggcccaggaagactccctg
ctggctgtgaggacatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ctctgtgcctgggaagtggtcagagcagaagtctggagagccctgtcttcctcagttaac
ttgctggcaagactgagtgaagagaaggcttga

KEGG   Mus caroli (Ryukyu mouse): 110292939
Entry
110292939         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-9-like
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110292939
   04151 PI3K-Akt signaling pathway
    110292939
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292939
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110292939
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110292939
   04621 NOD-like receptor signaling pathway
    110292939
   04622 RIG-I-like receptor signaling pathway
    110292939
   04623 Cytosolic DNA-sensing pathway
    110292939
   04650 Natural killer cell mediated cytotoxicity
    110292939
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292939
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110292939
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292939
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110292939
   05161 Hepatitis B
    110292939
   05160 Hepatitis C
    110292939
   05171 Coronavirus disease - COVID-19
    110292939
   05164 Influenza A
    110292939
   05162 Measles
    110292939
   05168 Herpes simplex virus 1 infection
    110292939
   05163 Human cytomegalovirus infection
    110292939
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292939
   05169 Epstein-Barr virus infection
    110292939
   05165 Human papillomavirus infection
    110292939
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110292939
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110292939
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110292939
NCBI-ProteinID: XP_021016288
Ensembl: MGP_CAROLIEiJ_G0026146
UniProt: A0A6P5PLB3
LinkDB
Position
4
AA seq 189 aa
MARPFAFLMVLVVMSYWSTCSLGCDLPQTHNLRNKKILTLMAQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQKAQAIPVLSELTQQILTLFTSKDSSAAWDATVLDSFCNDLHLQLNDLK
ACLMQQVGMQEPPLTQEDSLLAVKKYFRRITVYLREKKHSPCAWEVVRVEVWRALSSSAK
LLARLSEEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccctttgctttcctgatggtcttggtggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcaaactcataacctcaggaacaagaaaatcttgacactt
atggcacaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttgga
ttcccccaggagaaggtggatgcccagcagattcagaaggctcaagctattcctgtcctg
agtgagctgacccaacagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
gatgcaaccgtcctagactcattctgcaatgacctccatctgcagctcaatgacctcaaa
gcctgtctgatgcagcaagtggggatgcaggaacctcccctgacccaggaagactccctg
ctagctgtgaagaaatacttccgcaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagtagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagactgagcgaggaggagtga

KEGG   Mus caroli (Ryukyu mouse): 110292945
Entry
110292945         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110292945
   04151 PI3K-Akt signaling pathway
    110292945
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292945
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110292945
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110292945
   04621 NOD-like receptor signaling pathway
    110292945
   04622 RIG-I-like receptor signaling pathway
    110292945
   04623 Cytosolic DNA-sensing pathway
    110292945
   04650 Natural killer cell mediated cytotoxicity
    110292945
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292945
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110292945
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292945
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110292945
   05161 Hepatitis B
    110292945
   05160 Hepatitis C
    110292945
   05171 Coronavirus disease - COVID-19
    110292945
   05164 Influenza A
    110292945
   05162 Measles
    110292945
   05168 Herpes simplex virus 1 infection
    110292945
   05163 Human cytomegalovirus infection
    110292945
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292945
   05169 Epstein-Barr virus infection
    110292945
   05165 Human papillomavirus infection
    110292945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110292945
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110292945
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 110292945
NCBI-ProteinID: XP_021016292
Ensembl: MGP_CAROLIEiJ_G0026149
UniProt: A0A6P5PMS8
LinkDB
Position
4
AA seq 190 aa
MARLCAFLMALAVMSYWSTCPLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPVLLELTQQILNIFTSKDSSAAWDATLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRTEVWRALFSSAK
LLASLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctaatggccctggcagtgatgagctactggtcaacctgc
cctctaggatgtgacctgcctcaaactcataacctcaggaacaagagagccttgaccctc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggatgcccaacagatcaagaaggctcaagccatccctgtcctg
cttgagctgacccagcaaatcttgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcaaccctcctagactcattctgcaatgacctccatcagcagctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaagaacctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagaacagaagtctggagagccctgttttcctcagccaag
ttgctggcaagtctgagtgaggagaaggagtga

KEGG   Mus caroli (Ryukyu mouse): 110292969
Entry
110292969         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-9-like
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110292969
   04151 PI3K-Akt signaling pathway
    110292969
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292969
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110292969
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110292969
   04621 NOD-like receptor signaling pathway
    110292969
   04622 RIG-I-like receptor signaling pathway
    110292969
   04623 Cytosolic DNA-sensing pathway
    110292969
   04650 Natural killer cell mediated cytotoxicity
    110292969
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292969
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110292969
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292969
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110292969
   05161 Hepatitis B
    110292969
   05160 Hepatitis C
    110292969
   05171 Coronavirus disease - COVID-19
    110292969
   05164 Influenza A
    110292969
   05162 Measles
    110292969
   05168 Herpes simplex virus 1 infection
    110292969
   05163 Human cytomegalovirus infection
    110292969
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292969
   05169 Epstein-Barr virus infection
    110292969
   05165 Human papillomavirus infection
    110292969
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110292969
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110292969
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 110292969
NCBI-ProteinID: XP_021016330
Ensembl: MGP_CAROLIEiJ_G0026143
UniProt: A0A6P5PLF3
LinkDB
Position
4
AA seq 190 aa
MARPFAFLMVLVVMSYWSTCSLGCDLPQTHNLSNKKILTLIAQMRRLSPLSCLKNRKDFG
FPQEKVDVQQIQKAQAIPILNELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEPPLVQKDSLLAVRKYFHRITVYLREKKHSPCAWKVVRAEVWRALSSSVN
LLASLSKEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggccctttgctttcctgatggtcttggtggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcaaactcataacctcagcaacaagaaaatcttgacactt
atagcacaaatgaggagactctcccctctctcctgcctgaagaacaggaaggacttcgga
ttcccccaggagaaggtggatgtccagcagatccagaaggctcaagccatccctatcctg
aatgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
gggtgtctgatgcagcaggtgggggtgcaagagcctcccctggtccagaaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctggaaggtggtcagagcagaagtctggagagccctgtcttcctcagttaac
ttgctggcaagtctgagtaaggagaaggagtga

KEGG   Mus caroli (Ryukyu mouse): 110292975
Entry
110292975         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-1
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110292975
   04151 PI3K-Akt signaling pathway
    110292975
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292975
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110292975
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110292975
   04621 NOD-like receptor signaling pathway
    110292975
   04622 RIG-I-like receptor signaling pathway
    110292975
   04623 Cytosolic DNA-sensing pathway
    110292975
   04650 Natural killer cell mediated cytotoxicity
    110292975
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292975
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110292975
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292975
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110292975
   05161 Hepatitis B
    110292975
   05160 Hepatitis C
    110292975
   05171 Coronavirus disease - COVID-19
    110292975
   05164 Influenza A
    110292975
   05162 Measles
    110292975
   05168 Herpes simplex virus 1 infection
    110292975
   05163 Human cytomegalovirus infection
    110292975
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292975
   05169 Epstein-Barr virus infection
    110292975
   05165 Human papillomavirus infection
    110292975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110292975
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110292975
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110292975
NCBI-ProteinID: XP_021016338
UniProt: A0A6P5PRE9
LinkDB
Position
4
AA seq 189 aa
MARLCAFLMVLTVMSYWSTCSLGCDLPQTHNLGNKRTLTLLIQMRRLSPLSCLKYRKDFG
FPQEKVDAQHIQEAQAIPVLQELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLQ
GCLMQEVGVQELPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgcgctttcctgatggtcctgacagtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataacctcgggaacaagagaaccttgacactc
ttgatacaaatgaggagactctcccctctctcctgcctgaagtacagaaaggactttgga
ttcccccaggagaaggtggatgcccagcatatccaggaggctcaagccatccctgtccta
caagagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccatcagcagctcaacgacctgcaa
ggctgtctgatgcaggaggtgggggtgcaggaacttcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagt
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctctgccaat
gtgctgggaagactgagagaagagaaatga

KEGG   Mus caroli (Ryukyu mouse): 110292981
Entry
110292981         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110292981
   04151 PI3K-Akt signaling pathway
    110292981
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292981
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110292981
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110292981
   04621 NOD-like receptor signaling pathway
    110292981
   04622 RIG-I-like receptor signaling pathway
    110292981
   04623 Cytosolic DNA-sensing pathway
    110292981
   04650 Natural killer cell mediated cytotoxicity
    110292981
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292981
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110292981
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292981
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110292981
   05161 Hepatitis B
    110292981
   05160 Hepatitis C
    110292981
   05171 Coronavirus disease - COVID-19
    110292981
   05164 Influenza A
    110292981
   05162 Measles
    110292981
   05168 Herpes simplex virus 1 infection
    110292981
   05163 Human cytomegalovirus infection
    110292981
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292981
   05169 Epstein-Barr virus infection
    110292981
   05165 Human papillomavirus infection
    110292981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110292981
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110292981
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110292981
NCBI-ProteinID: XP_021016351
UniProt: A0A6P5PLG6
LinkDB
Position
4
AA seq 190 aa
MARLCAFLMILIVMSYWSTCSLGCNLPHTYNLRNKRALTVLAQMRRLPPLSCLKDRKDFG
FPLEKVDNQQIQKAQAIPVLRDLTQQILNLFTSKTSSAAWNATLLDSFCNDLHQQLSDLQ
GCLMQQVGMQEPPLTQEDSLLAVRKYFHRITVYLREKKHSLCAWEVVRTEVWRALSSSAK
FLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcctgatagtgatgagctactggtcaacctgt
tctctaggatgcaacctgcctcacacttataacctcaggaacaaaagggccttgacagtc
ctggcacagatgaggaggctcccccctctttcctgcctgaaggacaggaaggactttgga
ttccccttggagaaagtggataaccagcagatccagaaggctcaagccatccctgtgctg
cgagatcttactcagcagatcttgaacctcttcacatcaaagacttcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccatcagcagctcagtgacctgcaa
ggttgtctgatgcagcaggttgggatgcaggaacctcccctnacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ctctgtgcctgggaggtggtcagaacagaagtctggagagccctgtcttcctcagccaaa
tttctggcaagactgagtgaagagaaggagtga

KEGG   Mus caroli (Ryukyu mouse): 110293011
Entry
110293011         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-12-like
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110293011
   04151 PI3K-Akt signaling pathway
    110293011
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110293011
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110293011
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110293011
   04621 NOD-like receptor signaling pathway
    110293011
   04622 RIG-I-like receptor signaling pathway
    110293011
   04623 Cytosolic DNA-sensing pathway
    110293011
   04650 Natural killer cell mediated cytotoxicity
    110293011
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293011
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110293011
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110293011
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293011
   05161 Hepatitis B
    110293011
   05160 Hepatitis C
    110293011
   05171 Coronavirus disease - COVID-19
    110293011
   05164 Influenza A
    110293011
   05162 Measles
    110293011
   05168 Herpes simplex virus 1 infection
    110293011
   05163 Human cytomegalovirus infection
    110293011
   05167 Kaposi sarcoma-associated herpesvirus infection
    110293011
   05169 Epstein-Barr virus infection
    110293011
   05165 Human papillomavirus infection
    110293011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110293011
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110293011
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 110293011
NCBI-ProteinID: XP_021016409
UniProt: A0A6P5PK80
LinkDB
Position
4
AA seq 189 aa
MARLCAFLMALLLMSYWSTCCLGCDLPQTQKLRNKRALTLLVQMRRLSPLSCLKDRKNFR
FPLEKVDAQQIQKAQAIPFVRELTQQILTLFTSKDSSAAWNATLIDSFCNDLNDQLNDLQ
GCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLASLKEEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggccctgctgctgatgagctactggtcaacctgc
tgtctaggatgtgacctgccccagactcagaaactcagaaacaagagagccttaaccctc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacagaaagaactttaga
ttccccctggagaaggtggatgcccagcagatccagaaggctcaagccatcccttttgtg
cgtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
aatgcaaccctcatagactcattctgcaatgacctcaacgatcagctcaatgacctgcaa
ggctgtctgatgcagcaggtagagatacaggcacctcccctgacccaggaagattccctg
ctggctgtgaggaaatacttccacaggatcactgtttacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagcctgaaagaagagaagtga

KEGG   Mus caroli (Ryukyu mouse): 110293017
Entry
110293017         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-9
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110293017
   04151 PI3K-Akt signaling pathway
    110293017
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110293017
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110293017
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110293017
   04621 NOD-like receptor signaling pathway
    110293017
   04622 RIG-I-like receptor signaling pathway
    110293017
   04623 Cytosolic DNA-sensing pathway
    110293017
   04650 Natural killer cell mediated cytotoxicity
    110293017
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293017
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110293017
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110293017
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293017
   05161 Hepatitis B
    110293017
   05160 Hepatitis C
    110293017
   05171 Coronavirus disease - COVID-19
    110293017
   05164 Influenza A
    110293017
   05162 Measles
    110293017
   05168 Herpes simplex virus 1 infection
    110293017
   05163 Human cytomegalovirus infection
    110293017
   05167 Kaposi sarcoma-associated herpesvirus infection
    110293017
   05169 Epstein-Barr virus infection
    110293017
   05165 Human papillomavirus infection
    110293017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110293017
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110293017
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 110293017
NCBI-ProteinID: XP_021016417
UniProt: A0A6P5PFN1
LinkDB
Position
4
AA seq 190 aa
MARPFSFLMVLVVMSYWSTCSLGCDLPQTHNLRNKKILTLMAQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQKAQAIPVLSELTQQILTLFTSKDSSAAWDATLLDSFCTGLHQLLNDLQ
GCLMQLVGMKELPLTQEDSQLAMKKYFHKITVYLREKKHSPCAWEVVRAEVWRALSSSIN
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggcccttttctttcctgatggtcttggtggtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcaaactcataacctcaggaacaagaaaatcttgacactt
atggcacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggatgcccagcagattcagaaggctcaagccatccctgtcctg
agtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
gatgcaaccctcctagactcattctgcactggcctccatcagctgctcaatgacctgcaa
ggctgtctgatgcagctggttgggatgaaggaactgcccctgacccaggaagactcccag
ctggctatgaagaaatatttccacaagatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcaattaac
ttgctggcaagactgagtgaggagaaagagtga

KEGG   Mus caroli (Ryukyu mouse): 110293025
Entry
110293025         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110293025
   04151 PI3K-Akt signaling pathway
    110293025
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110293025
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110293025
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110293025
   04621 NOD-like receptor signaling pathway
    110293025
   04622 RIG-I-like receptor signaling pathway
    110293025
   04623 Cytosolic DNA-sensing pathway
    110293025
   04650 Natural killer cell mediated cytotoxicity
    110293025
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293025
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110293025
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110293025
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293025
   05161 Hepatitis B
    110293025
   05160 Hepatitis C
    110293025
   05171 Coronavirus disease - COVID-19
    110293025
   05164 Influenza A
    110293025
   05162 Measles
    110293025
   05168 Herpes simplex virus 1 infection
    110293025
   05163 Human cytomegalovirus infection
    110293025
   05167 Kaposi sarcoma-associated herpesvirus infection
    110293025
   05169 Epstein-Barr virus infection
    110293025
   05165 Human papillomavirus infection
    110293025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110293025
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110293025
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 110293025
NCBI-ProteinID: XP_021016427
UniProt: A0A6P5PFP2
LinkDB
Position
4
AA seq 181 aa
MARHCAFLMALIVMSYWSTCSLGSDLPQTQNLRNKKALTLLEQMRRLSPVFCLKYRKDFG
FPLEKVDAQHIQKAQAIPVLLELTQQVLNIFTSKDSSAAWDATILDSFCNNLHQQLNDLK
ACLMQQVGVQEPPLTQENSLLAVRKYFHGITVYLREKKHSPCAWEVVRTEVWRALSSCWQ
D
NT seq 546 nt   +upstreamnt  +downstreamnt
atggctaggcattgtgctttcctgatggccctcatagtgatgagctactggtcaacctgt
tctctagggagtgatctgcctcagacacaaaacctaaggaacaagaaagccttgacactc
ctagaacaaatgagaagactctcccctgtcttctgtctaaagtacagaaaggactttgga
ttccccttggagaaggtggatgcccagcatatccagaaggctcaagccatccctgttctc
cttgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcaaccattctagactcattctgcaataacctccatcagcagctcaatgacctcaaa
gcctgtctgatgcagcaagtgggggtgcaggaacctcccctgacccaggaaaactccctt
ctagctgtgaggaaatatttccacgggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagaacagaagtctggagagccctgtcttcttgctggcaa
gactga

KEGG   Mus caroli (Ryukyu mouse): 110293074
Entry
110293074         CDS       T05910                                 

Definition
(RefSeq) interferon alpha-12
  KO
K05414  interferon alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110293074
   04151 PI3K-Akt signaling pathway
    110293074
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110293074
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110293074
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110293074
   04621 NOD-like receptor signaling pathway
    110293074
   04622 RIG-I-like receptor signaling pathway
    110293074
   04623 Cytosolic DNA-sensing pathway
    110293074
   04650 Natural killer cell mediated cytotoxicity
    110293074
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293074
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110293074
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110293074
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293074
   05161 Hepatitis B
    110293074
   05160 Hepatitis C
    110293074
   05171 Coronavirus disease - COVID-19
    110293074
   05164 Influenza A
    110293074
   05162 Measles
    110293074
   05168 Herpes simplex virus 1 infection
    110293074
   05163 Human cytomegalovirus infection
    110293074
   05167 Kaposi sarcoma-associated herpesvirus infection
    110293074
   05169 Epstein-Barr virus infection
    110293074
   05165 Human papillomavirus infection
    110293074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110293074
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110293074
SSDB
Motif
Pfam: Interferon RIX1
Other DBs
NCBI-GeneID: 110293074
NCBI-ProteinID: XP_021016502
Ensembl: MGP_CAROLIEiJ_G0026142
UniProt: A0A6P5PLT4
LinkDB
Position
4
AA seq 190 aa
MARLCVFLMALLLMSYWSTCSLGCDLPQTHNLSNKRALTLLVQMRRLSPLSCLKDRKNFR
FPLEKVDSQQIQKAQAIPVLSELTQQILNLFTSKDSSAAWNATLLDSFCNDVHHQLNDLQ
GCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgttttcctgatggccctgctgctgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcaaactcataacctcagcaacaagagagccttgaccctc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacagaaagaactttaga
ttccccctggagaaggtggattcccagcagatccagaaggctcaagccatccctgtcctg
agtgagctgacgcagcagatcctgaacctcttcacatcaaaggattcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacgtccatcatcagctcaatgacctgcaa
ggctgtctgatgcagcaggtagagatacaggcaccccccctgacccaggaagattccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagactgagtgaggagaaggaatga

KEGG   Mus caroli (Ryukyu mouse): 110293791
Entry
110293791         CDS       T05910                                 

Gene name
Ifnb1
Definition
(RefSeq) interferon beta
  KO
K05415  interferon beta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04623  Cytosolic DNA-sensing pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04668  TNF signaling pathway
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110293791 (Ifnb1)
   04668 TNF signaling pathway
    110293791 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    110293791 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110293791 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110293791 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110293791 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    110293791 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    110293791 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    110293791 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    110293791 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110293791 (Ifnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110293791 (Ifnb1)
   05152 Tuberculosis
    110293791 (Ifnb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110293791 (Ifnb1)
   05161 Hepatitis B
    110293791 (Ifnb1)
   05160 Hepatitis C
    110293791 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    110293791 (Ifnb1)
   05164 Influenza A
    110293791 (Ifnb1)
   05162 Measles
    110293791 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    110293791 (Ifnb1)
   05163 Human cytomegalovirus infection
    110293791 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110293791 (Ifnb1)
   05169 Epstein-Barr virus infection
    110293791 (Ifnb1)
   05165 Human papillomavirus infection
    110293791 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110293791 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110293791 (Ifnb1)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interferons
   110293791 (Ifnb1)
SSDB
Motif
Pfam: Interferon Spore_III_AB YebO Tat
Other DBs
NCBI-GeneID: 110293791
NCBI-ProteinID: XP_021017316
Ensembl: MGP_CAROLIEiJ_G0026141
UniProt: A0A6P5PTS9
LinkDB
Position
4
AA seq 182 aa
MNNRWILHAAFLLCFSTTALSINYEQLQLQQRTNLRKCQKLLEQLNGKINLTYRTDFKIP
MEMTEKMQKSHSAFAIQEMLQNVFLVFRNNFSSTGWNETLVERLLDELHQQTVFLKKILE
EKQEERLTWETSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFFIIRRLTRNF
QK
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaacaacaggtggatcctccacgctgcgttcctgctgtgcttctccaccacagccctc
tccatcaactacgagcagctccagctccaacaaaggacgaaccttcggaaatgtcagaag
ctcctggagcagctgaatggaaagatcaacctcacctacaggacggacttcaagatccct
atggagatgacggagaagatgcagaagagtcactctgcctttgccatccaagagatgctc
cagaatgtctttcttgtcttcagaaacaatttctccagcactgggtggaatgagactctt
gttgaacgtctcctggatgaactccaccagcagacagtgtttctgaagaaaatactagag
gaaaagcaagaagaaagattgacgtgggagacgtcctcaactgctctccacttgaagagc
tattactggagggtgcaaaggtaccttaaactcatgaagtacaacagctacgcctggatg
gtggtccgagcagagatcttcaggaactttttcatcatccgaagacttaccagaaacttc
caaaaatga

DBGET integrated database retrieval system