Mus caroli (Ryukyu mouse): 110288823 Help Entry 110288823         CDS       T05910                                  Gene name Bcl2l1 Definition (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mcal  Mus caroli (Ryukyu mouse) Pathway mcal01521   EGFR tyrosine kinase inhibitor resistance mcal01524   Platinum drug resistance mcal04014   Ras signaling pathway mcal04064   NF-kappa B signaling pathway mcal04115   p53 signaling pathway mcal04137   Mitophagy - animal mcal04140   Autophagy - animal mcal04151   PI3K-Akt signaling pathway mcal04210   Apoptosis mcal04215   Apoptosis - multiple species mcal04621   NOD-like receptor signaling pathway mcal04630   JAK-STAT signaling pathway mcal05012   Parkinson disease mcal05014   Amyotrophic lateral sclerosis mcal05022   Pathways of neurodegeneration - multiple diseases mcal05145   Toxoplasmosis mcal05162   Measles mcal05166   Human T-cell leukemia virus 1 infection mcal05168   Herpes simplex virus 1 infection mcal05170   Human immunodeficiency virus 1 infection mcal05200   Pathways in cancer mcal05202   Transcriptional misregulation in cancer mcal05212   Pancreatic cancer mcal05220   Chronic myeloid leukemia mcal05222   Small cell lung cancer mcal05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mcal00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110288823 (Bcl2l1)    04630 JAK-STAT signaling pathway     110288823 (Bcl2l1)    04064 NF-kappa B signaling pathway     110288823 (Bcl2l1)    04151 PI3K-Akt signaling pathway     110288823 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110288823 (Bcl2l1)    04137 Mitophagy - animal     110288823 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     110288823 (Bcl2l1)    04215 Apoptosis - multiple species     110288823 (Bcl2l1)    04115 p53 signaling pathway     110288823 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110288823 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110288823 (Bcl2l1)    05202 Transcriptional misregulation in cancer     110288823 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     110288823 (Bcl2l1)    05225 Hepatocellular carcinoma     110288823 (Bcl2l1)    05220 Chronic myeloid leukemia     110288823 (Bcl2l1)    05222 Small cell lung cancer     110288823 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     110288823 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     110288823 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     110288823 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110288823 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     110288823 (Bcl2l1)    05162 Measles     110288823 (Bcl2l1)    05168 Herpes simplex virus 1 infection     110288823 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110288823 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110288823 (Bcl2l1)    01524 Platinum drug resistance     110288823 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mcal01009]     110288823 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mcal03036]     110288823 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mcal02000]     110288823 (Bcl2l1) Protein phosphatases and associated proteins [BR:mcal01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110288823 (Bcl2l1) Chromosome and associated proteins [BR:mcal03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     110288823 (Bcl2l1) Transporters [BR:mcal02000]  Other transporters   Pores ion channels [TC:1]    110288823 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  110288823 NCBI-ProteinID:  XP_021010729 Ensembl:  MGP_CAROLIEiJ_G0024473 UniProt:  A0A6P5P935 LinkDB All DBs Position 2 AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggtcgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtcgaagagaataggactgaggccccagaagaa actgaagcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg gatagccccgccgtgaatggagccactggccacagcagcagtttggatgcgcgggaggtg atccccatggcagcagtgaagcaagcgctgagagaggctggcgatgagtttgaactgcgg taccggagagcgttcagtgatctaacatcccagcttcacataaccccagggaccgcgtat cagagctttgagcaggtagtgaatgaactctttcgggatggagtaaactggggtcgcatc gtggcctttttctcctttggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcaagttggatggccacctatctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggatctctacgggaacaatgcagca gccgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcactcttcagtcggaagtga

DBGET integrated database retrieval system