KEGG   Mus caroli (Ryukyu mouse): 110288823
Entry
110288823         CDS       T05910                                 

Gene name
Bcl2l1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01524  Platinum drug resistance
mcal04014  Ras signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04115  p53 signaling pathway
mcal04137  Mitophagy - animal
mcal04140  Autophagy - animal
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04621  NOD-like receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal05012  Parkinson disease
mcal05014  Amyotrophic lateral sclerosis
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05145  Toxoplasmosis
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05168  Herpes simplex virus 1 infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110288823 (Bcl2l1)
   04630 JAK-STAT signaling pathway
    110288823 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    110288823 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    110288823 (Bcl2l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110288823 (Bcl2l1)
   04137 Mitophagy - animal
    110288823 (Bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    110288823 (Bcl2l1)
   04215 Apoptosis - multiple species
    110288823 (Bcl2l1)
   04115 p53 signaling pathway
    110288823 (Bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110288823 (Bcl2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110288823 (Bcl2l1)
   05202 Transcriptional misregulation in cancer
    110288823 (Bcl2l1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110288823 (Bcl2l1)
   05225 Hepatocellular carcinoma
    110288823 (Bcl2l1)
   05220 Chronic myeloid leukemia
    110288823 (Bcl2l1)
   05222 Small cell lung cancer
    110288823 (Bcl2l1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110288823 (Bcl2l1)
   05014 Amyotrophic lateral sclerosis
    110288823 (Bcl2l1)
   05022 Pathways of neurodegeneration - multiple diseases
    110288823 (Bcl2l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110288823 (Bcl2l1)
   05170 Human immunodeficiency virus 1 infection
    110288823 (Bcl2l1)
   05162 Measles
    110288823 (Bcl2l1)
   05168 Herpes simplex virus 1 infection
    110288823 (Bcl2l1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110288823 (Bcl2l1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110288823 (Bcl2l1)
   01524 Platinum drug resistance
    110288823 (Bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110288823 (Bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110288823 (Bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110288823 (Bcl2l1)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110288823 (Bcl2l1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110288823 (Bcl2l1)
Transporters [BR:mcal02000]
 Other transporters
  Pores ion channels [TC:1]
   110288823 (Bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 110288823
NCBI-ProteinID: XP_021010729
Ensembl: MGP_CAROLIEiJ_G0024473
UniProt: A0A6P5P935
LinkDB
Position
2
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggtcgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtcgaagagaataggactgaggccccagaagaa
actgaagcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gatagccccgccgtgaatggagccactggccacagcagcagtttggatgcgcgggaggtg
atccccatggcagcagtgaagcaagcgctgagagaggctggcgatgagtttgaactgcgg
taccggagagcgttcagtgatctaacatcccagcttcacataaccccagggaccgcgtat
cagagctttgagcaggtagtgaatgaactctttcgggatggagtaaactggggtcgcatc
gtggcctttttctcctttggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggattgcaagttggatggccacctatctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggatctctacgggaacaatgcagca
gccgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctcactcttcagtcggaagtga

DBGET integrated database retrieval system