KEGG   Mus caroli (Ryukyu mouse): 110288882
Entry
110288882         CDS       T05910                                 

Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal05160  Hepatitis C
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110288882
   04151 PI3K-Akt signaling pathway
    110288882
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110288882
   04114 Oocyte meiosis
    110288882
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110288882
  09172 Infectious disease: viral
   05160 Hepatitis C
    110288882
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110288882
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110288882
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110288882
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110288882
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110288882
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110288882
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 110288882
NCBI-ProteinID: XP_021010782
UniProt: A0A6P5PD09
LinkDB
Position
Unknown
AA seq 130 aa
MGDREQLLQRARLAEQAERYDHMASTMKAIGQVTELNEPLSNEDRNLLSVAYKNVVGARR
SSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQY
ESKVFYLKMK
NT seq 391 nt   +upstreamnt  +downstreamnt
atgggggatcgagagcagctgctgcagcgggcgcgactggcggagcaggcggagcgctac
gaccatatggcctccaccatgaaggctatagggcaggtgacagagctgaatgaaccccta
tctaatgaagatagaaatctcctctctgtggcctacaagaatgtagttggtgccaggcga
tcttcttggagggttattagtagcattgagcagaaaaccatggcagatgggaacgagaag
aagttggagaaagttaaagcctaccgggagaagattgaaaaggagctggagacagtttgt
aatgatgtcttggctctgcttgacaagttccttatcaagaactgcaatgattttcagtat
gagagcaaagtgttctacctgaaaatgaagg

KEGG   Mus caroli (Ryukyu mouse): 110294181
Entry
110294181         CDS       T05910                                 

Gene name
Ywhah
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal05160  Hepatitis C
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110294181 (Ywhah)
   04151 PI3K-Akt signaling pathway
    110294181 (Ywhah)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110294181 (Ywhah)
   04114 Oocyte meiosis
    110294181 (Ywhah)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110294181 (Ywhah)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110294181 (Ywhah)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110294181 (Ywhah)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110294181 (Ywhah)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110294181 (Ywhah)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110294181 (Ywhah)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110294181 (Ywhah)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110294181 (Ywhah)
SSDB
Motif
Pfam: 14-3-3 SF3A2 Ima1_N DUF722 DUF4686 CodY
Other DBs
NCBI-GeneID: 110294181
NCBI-ProteinID: XP_021017876
UniProt: A0A6P5PJ70
LinkDB
Position
5
AA seq 272 aa
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAADSLDTQALSSDVFQVTELNEPLSNEDR
NLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLG
TLYIVATLSERCSDALPGFRSPRLTQVKLRKR
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggggatcgagagcagctgctgcagcgggcgcgactggcggagcaggcggagcgctac
gacgatatggcctccgccatgaaggcggtgacagagctgaatgaaccgctatctaatgaa
gatagaaatctcctctctgtggcctacaagaatgtagttggtgccaggcgatcttcttgg
agggttattagtagcattgagcagaaaaccatggcagatgggaatgagaagaagttggag
aaagttaaagcctaccgggagaagattgaaaaggagctggagacagtttgtaatgatgtc
ttggctctgcttgacaagttccttatcaagaactgcaatgattttcagtatgagagcaag
gtgttctacctgaaaatgaagggcgattactaccgctacctggcagaggtggcttctggg
gagaagaaaaacagtgtggttgaagcttctgaggccgcggactctctggatactcaggct
ttgtcctctgatgttttccaggtgacagagctgaatgaaccgctatctaatgaagataga
aatctcctctctgtggcctacaagaatgtagttggtgccaggcgatcttcttggagggtt
attagtagcattgagcagaaaaccatggcagatgggaatgagaagaagttggagaaagtt
aaagcctaccgggagaagattgaaaaggagctggagacagtttgtaatgatgtcttgggg
acgttgtacatcgtggcgaccttgtcagagcgctgcagtgacgcactccctggattccgc
agccctcggctgacacaggtgaaattgagaaagaggtag

KEGG   Mus caroli (Ryukyu mouse): 110294960
Entry
110294960         CDS       T05910                                 

Gene name
Ywhag
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal05160  Hepatitis C
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110294960 (Ywhag)
   04151 PI3K-Akt signaling pathway
    110294960 (Ywhag)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110294960 (Ywhag)
   04114 Oocyte meiosis
    110294960 (Ywhag)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110294960 (Ywhag)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110294960 (Ywhag)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110294960 (Ywhag)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110294960 (Ywhag)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110294960 (Ywhag)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110294960 (Ywhag)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110294960 (Ywhag)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110294960 (Ywhag)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98
Other DBs
NCBI-GeneID: 110294960
NCBI-ProteinID: XP_021019067
Ensembl: MGP_CAROLIEiJ_G0027846
UniProt: A0A6P5PYA3
LinkDB
Position
5
AA seq 204 aa
MVDREQLVQKARLAEQAERYDDMAAAMKNDGNEKKIEMVRAYREKIEKELEAVCQDVLSL
LDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKE
HMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIM
QLLRDNLTLWTSDQQDDDGGEGNN
NT seq 615 nt   +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgatatggccgcggccatgaagaacgacggcaacgagaagaagatcgagatggtccga
gcctaccgggagaagatcgagaaggagctggaggccgtgtgccaggacgtgctgagcctg
ctggacaactacctgatcaagaactgcagcgagacccagtacgagagcaaggtgttctac
ctgaagatgaaaggggactattaccgttacctggcagaagtggccaccggggagaagagg
gcgactgtggtggagtcgtctgagaaggcctacagcgaagcccacgagatcagcaaggag
cacatgcagcccacccaccccatccggctgggcctggcgctcaactactccgttttctac
tatgagatccagaacgccccggagcaagcgtgccacctggccaagaccgccttcgacgac
gccatcgcngagctcgacactctgaacgaggactcctacaaggactccactctgatcatg
cagctgctccgagacaacctcacgctctggacgagcgaccagcaagacgatgacggcggt
gaaggcaacaactaa

KEGG   Mus caroli (Ryukyu mouse): 110305021
Entry
110305021         CDS       T05910                                 

Gene name
Ywhae
Definition
(RefSeq) 14-3-3 protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal05160  Hepatitis C
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110305021 (Ywhae)
   04151 PI3K-Akt signaling pathway
    110305021 (Ywhae)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110305021 (Ywhae)
   04114 Oocyte meiosis
    110305021 (Ywhae)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110305021 (Ywhae)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110305021 (Ywhae)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110305021 (Ywhae)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110305021 (Ywhae)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110305021 (Ywhae)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110305021 (Ywhae)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110305021 (Ywhae)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110305021 (Ywhae)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 110305021
NCBI-ProteinID: XP_021032419
Ensembl: MGP_CAROLIEiJ_G0016748
UniProt: A0A6P5QPV5
LinkDB
Position
11
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggcagagcaggccgagcgatac
gacgaaatggtggaatcaatgaagaaagtagcagggatggacgtggagctgacagttgaa
gaacgaaaccttttatctgttgcatataaaaatgtgattggagccagaagagcatcctgg
agaataatcagcagcattgaacagaaggaagaaaacaagggaggagaggacaaattaaag
atgattcgggagtaccggcaaatggttgaaactgagctcaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgagtttgccacaggaaatgac
aggaaggaggcagcagagaacagcctcgtggcttacaaagctgctagtgacattgcgatg
acagaacttcctccaacgcaccccattcgtttaggtcttgctctcaacttttccgtattc
tactatgaaattcttaattcccccgaccgtgcctgcaggttggcaaaagcagcttttgat
gacgcaattgcagaactggacacgctgagtgaagaaagctataaggactctacgctcatc
atgcagctgctacgtgataacctgacgctgtggacctcagacatgcagggcgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgagaatcagtga

KEGG   Mus caroli (Ryukyu mouse): 110306902
Entry
110306902         CDS       T05910                                 

Gene name
Ywhaq
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110306902 (Ywhaq)
   04151 PI3K-Akt signaling pathway
    110306902 (Ywhaq)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110306902 (Ywhaq)
   04114 Oocyte meiosis
    110306902 (Ywhaq)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110306902 (Ywhaq)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110306902 (Ywhaq)
   05160 Hepatitis C
    110306902 (Ywhaq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110306902 (Ywhaq)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110306902 (Ywhaq)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110306902 (Ywhaq)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110306902 (Ywhaq)
SSDB
Motif
Pfam: 14-3-3 FliM
Other DBs
NCBI-GeneID: 110306902
NCBI-ProteinID: XP_021034719
Ensembl: MGP_CAROLIEiJ_G0017643
UniProt: A0A6P5QTL5
LinkDB
Position
12
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctgtcggtggcctacaaaaacgtggtagggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgacacctctgacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtcggagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtagcttgtggcgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
cagcctacgcatccgatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatccagagcttgcctgcacactggctaaaacggcttttgatgaggccatc
gcagagcttgatacactgaacgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagca
gaaggggccgaaaactaa

KEGG   Mus caroli (Ryukyu mouse): 110310210
Entry
110310210         CDS       T05910                                 

Gene name
Ywhaz
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110310210 (Ywhaz)
   04151 PI3K-Akt signaling pathway
    110310210 (Ywhaz)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110310210 (Ywhaz)
   04114 Oocyte meiosis
    110310210 (Ywhaz)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110310210 (Ywhaz)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110310210 (Ywhaz)
   05160 Hepatitis C
    110310210 (Ywhaz)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110310210 (Ywhaz)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110310210 (Ywhaz)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110310210 (Ywhaz)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110310210 (Ywhaz)
SSDB
Motif
Pfam: 14-3-3 AAA_15 CSN7a_helixI FliM
Other DBs
NCBI-GeneID: 110310210
NCBI-ProteinID: XP_021038614
Ensembl: MGP_CAROLIEiJ_G0019741
UniProt: A0A6P7QG65
LinkDB
Position
15
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaatgagctggtgcagaaggccaagctggccgagcaggcagagcgatatgat
gacatggcagcctgcatgaagtctgtcactgagcagggagctgagctgtcgaatgaggag
aggaaccttctctctgttgcttataaaaacgttgtaggagcccgtaggtcatcgtggagg
gtcgtctcaagtattgagcagaagacggaaggtgctgagaaaaagcagcagatggctcga
gaatacagagagaagatcgagacggagctgcgtgacatctgcaacgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcgcaaccagaaagcaaagtcttctatttgaaa
atgaagggtgactactaccgttacttggctgaggttgctgctggtgatgacaagaaagga
attgtggaccagtcacagcaagcataccaagaagcattcgaaatcagcaaaaaggagatg
cagccgacacaccccatcagactgggtctggccctcaacttctctgtgttctattacgag
atcctgaactccccagagaaagcctgctctcttgcaaaaacagctttcgatgaagccatt
gctgaacttgatacattaagtgaagagtcgtacaaagacagcacgctaataatgcagtta
ctgagagacaacttaacattgtggacatcggatacccaaggagatgaagcagaagcggga
gaaggaggggaaaattaa

KEGG   Mus caroli (Ryukyu mouse): 110312563
Entry
110312563         CDS       T05910                                 

Gene name
Ywhab
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04151  PI3K-Akt signaling pathway
mcal04390  Hippo signaling pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110312563 (Ywhab)
   04151 PI3K-Akt signaling pathway
    110312563 (Ywhab)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110312563 (Ywhab)
   04114 Oocyte meiosis
    110312563 (Ywhab)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312563 (Ywhab)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110312563 (Ywhab)
   05160 Hepatitis C
    110312563 (Ywhab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110312563 (Ywhab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110312563 (Ywhab)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110312563 (Ywhab)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110312563 (Ywhab)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98 FliM SF3A2
Other DBs
NCBI-GeneID: 110312563
NCBI-ProteinID: XP_021041922
Ensembl: MGP_CAROLIEiJ_G0024626
UniProt: A0A6P5R3N9
LinkDB
Position
2
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataagagtgagctggtacagaaagccaaactggctgagcaggctgagcgc
tatgatgacatggctgcagctatgaaggccgtaacagaacagggacacgaactctccaat
gaagagaggaatctactctctgttgcctacaagaacgtggtaggtgcccgccgctcttcc
tggcgtgtcatctccagcatcgaacagaaaaccgagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatcgaggcggagctgcaggacatctgcaacgacgtgctg
gagctgttggacaaatatctcattctcaatgctacccaggcagaaagcaaagtgttctac
ttaaaaatgaaaggagactattttaggtatctttctgaagttgcatctggagataataaa
caaaccacggtgtcaaactcccagcaggcttaccaagaagcatttgaaatcagcaagaaa
gaaatgcaacctacacacccgattcgcctcggcctggcgctgaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgcagcctggccaaaacggcatttgatgag
gcgattgctgagttggacaccctgaatgaagagtcttacaaggacagcaccctgatcatg
cagctgctcagggacaatctcaccctgtggacgtcagaaaaccagggggatgaaggagat
gctggagagggagagaactaa

DBGET integrated database retrieval system