KEGG   Mus caroli (Ryukyu mouse): 110289304
Entry
110289304         CDS       T05910                                 

Gene name
Cacna1b
Definition
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B isoform X1
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04721  Synaptic vesicle cycle
mcal04723  Retrograde endocannabinoid signaling
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04930  Type II diabetes mellitus
mcal05016  Huntington disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05032  Morphine addiction
mcal05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110289304 (Cacna1b)
   04020 Calcium signaling pathway
    110289304 (Cacna1b)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    110289304 (Cacna1b)
   04725 Cholinergic synapse
    110289304 (Cacna1b)
   04728 Dopaminergic synapse
    110289304 (Cacna1b)
   04726 Serotonergic synapse
    110289304 (Cacna1b)
   04723 Retrograde endocannabinoid signaling
    110289304 (Cacna1b)
   04721 Synaptic vesicle cycle
    110289304 (Cacna1b)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    110289304 (Cacna1b)
   05020 Prion disease
    110289304 (Cacna1b)
   05022 Pathways of neurodegeneration - multiple diseases
    110289304 (Cacna1b)
  09165 Substance dependence
   05032 Morphine addiction
    110289304 (Cacna1b)
   05033 Nicotine addiction
    110289304 (Cacna1b)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110289304 (Cacna1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110289304 (Cacna1b)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110289304 (Cacna1b)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 110289304
NCBI-ProteinID: XP_021011113
Ensembl: MGP_CAROLIEiJ_G0023239
UniProt: A0A6P5PDW1
LinkDB
Position
2
AA seq 2327 aa
MVRFGDELGGRYGGTGGGERARGGGAGGAGGPGQGGLPPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDTEPVGDFPCGKDPPARQCDGDTECREYWPGPNFGITNFDNI
LFAILTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDVLKRAA
TKKSRNDLIHAEEGEDRFVDLCAVGSPFARASLKSGKAESSSYFRRKEKMFRFFIRRMVK
AQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAARQQNSAKARSVWEQRASQLRLQNL
RASCEALYSEMDPEERLRYASTRHVRPDMKTHMDRPLVVEPGRDGLRGPVGSKSKPEGTE
ATESADLPRRHHRHRDRDKTTATAPAGGEQDRTESTETGVREERARPRRSHSKEAPGADT
QVRCERSRRHHRRGSPEEATEREPRRHRAHRHAQDSSKEGTAPVLVPKGERRARHRGPRT
GPREAENNEEPTRRHRARHKVPPTLQPPEREAAEKESNVVEGDKETRNHQPKEPHCDLET
IAVTGVGPLHMLPSTCLQKVDEQPEDADNQRNVTRMGSQPSDPSTTVHVPVTLTGPPGET
PVVPSGNTNLEGQAEGKKEAEADDVLRRGPRPIVPYSSMFCLSPTNLLRRFCHYIVTMRY
FEMVILVVIALSSIALAAEDPVRTDSFRNNALKYMDYIFTGVFTFEMVIKMIDLGLLLHP
GAYFRDLWNILDFIVVSGALVAFAFSSFMGGSKGKDINTIKSLRVLRVLRPLKTIKRLPK
LKAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELERDCRGQYL
DYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSVDATYEEQGPSPG
FRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAISAK
PLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLKCLN
IVFTSMFSMECILKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEIANNFINLSFLRL
FRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDDE
TSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLGNRACDPHANASECGSDFAYFYFV
SFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACGRISYNDM
FEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISNEDMTVHFTSTLMALIRTALEIKLAP
AGTKQHQCDAELRKEISSVWANLPQKTLDLLVPPHKPDEMTVGKVYAALMIFDFYKQNKT
TRDQTHQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSATSLSNGGAIQTQ
ESGIKESLSWGTQRTQDALYEARAPLERGHSAEIPVGQSGTLAVDVQMQNMTLRGPDGEP
QPGLESQGRAASMPRLAAETQPAPNASPMKRSISTLAPRPHGTQLCSTVLDRPPPSQASH
HHHHRCHRRRDKKQRSLEKGPSLSVDPEGAPSTAAGPGLPHGEGSTGCRRDRKQERGRSQ
ERRQPSSSSSEKQRFYSCDRFGSREPPQLKPSLSSHPTSPTAALEPGPHPQGSGSVNGSP
LMSTSGASTPGRGGRRQLPQTPLTPRPSITYKTANSSPVHFAEGQSGLPAFSPGRLSRGL
SEHNALLQKEPPSQPLAPGSRIGSDPYLGQRLDSEASAHTLPEDTLTFEEAVATNSGRSS
RTSYVSSLTSQSHPLRRVPNGYHCTLGLSTGVRARHSYHHPDQDHWC
NT seq 6984 nt   +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctaggcggccgctatgggggcaccggcggcggggagcgg
gctcggggcggcggggccggcggggcgggtggcccgggccaggggggtctgccgccgggc
cagcgggtcctgtacaagcagtccattgcgcagcgcgcacggaccatggctctgtacaac
cccatcccagtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatacgctaagcgcatcaccgaatggccgcccttcgaatacatg
atcctggctaccatcatcgccaactgcattgttctggccctggagcagcaccttcctgat
ggggacaagactcccatgtctgagcgactagatgacacggagccttacttcatcgggatc
ttttgcttcgaggcgggcatcaagatcatagccctgggctttgttttccacaagggctcc
taccttcggaacggctggaacgtcatggacttcgtggtggtcctcacggggattctcgcc
acagctggaactgactttgacctgcgcacactgagggctgtgcgtgtgcttaggcccctg
aagctggtgtctggaattccaagcttgcaggtggtgcttaagtccatcatgaaggccatg
gtcccgctgctgcagattgggctgctgctcttctttgccatcctcatgtttgccatcatc
ggcctcgagttctatatgggcaaattccataaggcctgtttccccaacagcacagataca
gagcctgtgggtgactttccctgtggcaaagatccccctgctcgtcagtgtgatggtgac
accgaatgccgggagtactggccaggacccaactttggtatcaccaattttgacaacatc
ctgtttgccatcttgacagtgttccagtgtatcaccatggagggctggactgacatcctc
tacaatacaaatgatgcggctggcaacacgtggaactggttgtacttcatccccctcatc
attattggctccttcttcatgctcaacctggtgctgggtgtgctttcaggagagtttgcc
aaggagcgggagcgagtcgagaaccgccgcgccttcctgaagctccgcaggcagcagcag
attgagcgagagctgaatgggtacttggagtggatcttcaaggcagaggaagtcatgttg
gcagaggaggacaagaatgcagaagagaagtcccctttggatgtgttgaagagagctgcc
accaagaagagccgaaatgacctcatccatgcagaagagggggaggaccggtttgtagac
ctctgtgcagttgggtctccatttgctcgtgccagcctcaagagtgggaaggcggagagc
tcctcatacttccggagaaaggagaagatgttccggttctttatccggcgtatggtgaag
gcgcagagcttctactgggtggtgctgtgtgtggtggccctgaacacattgtgtgtggcc
atggtgcactataatcagcctcagcggcttaccactgcactgtactttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctagggcccagaagt
tacttcaggtcttccttcaactgctttgactttggggtgattgtggggagtatctttgaa
gtagtctgggctgccatcaagccaggaacctcctttggaatcagtgtgctgcgggctctg
cgattgctgaggatattcaaagttaccaagtattggaactccctgcggaacctggtggtt
tccctcctcaactccatgaagtccatcatcagccttctcttcctgcttttcctcttcatc
gtggtcttcgctctgttggggatgcagctgtttgggggacagttcaactttcaagatgag
actccaaccaccaattttgataccttcccagctgccatcctcactgtctttcagatcctg
acaggagaggactggaatgccgtaatgtatcatgggattgagtcacaaggtggagtcagc
aaaggcatgttttcttccttttacttcatcgtcctgacactgtttggaaactacaccctg
ctgaatgtttttctggccattgctgtggacaaccttgccaatgcccaggaattgaccaag
gatgaagaggagatggaagaagctgccaatcagaaacttgctcttcagaaggccaaagaa
gtagctgaagtcagccccatgtctgctgccaatatctccatcgctgccaggcagcagaac
tcggccaaggcgcgctcagtatgggagcagcgggccagtcagctaaggctccagaatctg
cgtgccagctgtgaggcattgtacagtgagatggaccctgaggagcgcctgcgttatgcc
agcacgcgccatgtgaggccagacatgaagacacacatggaccgacctctagtggtggag
cctggtcgagatggcttgcggggacccgttgggagcaagtcaaagcctgaaggcacggag
gccacagaaagcgcggacctaccacgccggcaccaccggcatcgtgatagggacaagacc
acagccacagcacctgctggaggcgaacaggacaggacagaaagcaccgagaccggggtc
cgggaggaacgtgcgcgtcctcgtcgaagtcacagcaaggaggctccaggggctgacacg
caagtgcgctgtgagcgaagtaggcggcaccaccggcgcggctccccggaggaggctact
gaacgggagcctcggcgccaccgtgcccaccggcatgcacaggactcaagcaaggagggc
actgcgccggtgcttgtacccaagggtgagcgacgagcaagacaccgaggcccacgcacg
ggtccacgtgaggcagagaacaacgaggagcccacacgcaggcaccgtgcaaggcataag
gtgccacccacactgcagcccccagagagggaggctgcagagaaggagagcaacgtggtg
gaaggggataaggaaacccgaaatcaccagccaaaggaacctcactgtgacctggagacc
attgcagttacaggtgtgggccctctgcacatgctgcccagcacctgtctccagaaagtg
gacgagcaaccagaggatgcagacaaccagcgtaatgtcacccggatgggcagtcagccc
tcagatcccagcaccactgtgcatgtcccagtgacactgacaggccctcctggggagacc
cctgtagttcccagtggtaacacgaacctggaaggccaagcagagggcaagaaggaggca
gaggcggatgatgtactgagaagaggccccaggcccatcgttccctacagctccatgttt
tgtctcagccccaccaacctgcttcgtcgcttctgccattacattgtgaccatgcggtac
tttgagatggtaattcttgtggtcattgccttgagcagcattgccctggctgcagaggat
cctgtgcggactgattcattcaggaacaacgctttaaagtacatggattacatctttaca
ggagtcttcacctttgaaatggtcataaagatgatagacttgggcttgctgctgcaccct
ggtgcctacttccgggacctgtggaacattctggacttcattgttgtcagtggagccctg
gtggcatttgcattctcgagcttcatgggaggatccaaagggaaagacatcaataccatc
aagtctctgagagtcctgcgtgtcctgaggcccctcaagaccatcaagcggctgcctaag
ctcaaggctgtctttgactgtgtggtgaactctctgaagaacgtcttgaacatcctgatt
gtctacatgctcttcatgttcatatttgccgtcattgcagtccagctcttcaaagggaag
ttcttttactgtactgatgaatccaaggagctggagagggactgccggggtcagtatttg
gattatgagaaggaagaagtagaagcccagccaaggcagtggaagaaatatgacttccac
tatgacaatgttctctgggccttgttgacgctgttcacagtgtccacaggagaggggtgg
cccatggtgctgaaacactctgtggatgccacctatgaggaacagggacccagccccggg
ttccggatggagctctccatcttctacgtggtctactttgtcgtcttcccttttttcttt
gtcaacatctttgtggccttgatcattatcaccttccaggaacagggggacaaggtgatg
tctgaatgcagcctagaaaagaatgagagggcttgcattgattttgccatcagtgccaag
cccctgacacgatacatgcctcaaaacaaacagtcgttccagtataagacatggacattc
gtggtctctccaccctttgagtacttcatcatggctatgatagccctcaacacagtggtg
ctgatgatgaagttctatgatgcaccttatgagtacgagctgatgctgaaatgcctgaac
attgtcttcacatccatgttctcaatggagtgcatactgaagatcatcgcctttggggta
ttgaactacttcagagatgcctggaacgtttttgactttgtcacggttttgggaagtatt
actgatattttagtaacagagattgcgaacaacttcatcaacctaagcttccttcgcctc
ttccgggcagcacggctgatcaagctgcttcgccagggctacaccatccgcatcctgttg
tggaccttcgtccagtcctttaaggcgctgccctacgtgtgcctcctcattgccatgctg
ttcttcatctacgccatcatcggcatgcaggtttttggaaacattgcccttgatgatgaa
accagtatcaaccgacacaacaacttccggacatttctgcaagccttaatgctattgttc
aggagtgccactggggaggcctggcatgagatcatgctgtcttgtctgggcaaccgggcc
tgtgacccacatgccaatgccagtgagtgcgggagcgactttgcctatttttattttgtc
tccttcatcttcctctgttcctttctgatgttgaacctctttgttgctgtaatcatggac
aattttgagtacctcactcgggactcttccatcctagggcctcaccacttagacgaattc
attcgagtctgggctgaatacgacccagctgcgtgtgggcgcatcagttacaatgacatg
tttgagatgctgaaacacatgtccccacctctggggttggggaagaaatgcccggctcga
gttgcatacaagcgcctggttcgcatgaacatgcccatatccaatgaggacatgacggtg
cactttacatccacactgatggccctcatccggacagcactggagatcaagcttgcccca
gcggggacgaagcagcaccagtgtgatgctgagctgagaaaagagatctcttctgtgtgg
gctaatctgccccagaagactctggacttactggtaccaccccacaaacctgacgagatg
acagtggggaaggtctatgctgctctcatgatatttgacttctacaaacagaacaaaacc
acccgagatcagactcaccaagctcccggaggcctgtcccagatgggtcccgtttccctg
ttccaccctctgaaggccaccctggagcagacacagcccgctgtgctccgaggagctcgg
gttttccttcggcaaaagagtgcaacttccctcagcaatgggggtgccatacaaacccag
gaaagtggcatcaaggagtcgctgtcctggggcacgcagaggacccaagatgcactttat
gaggccagagcacctctagaacgtggccattctgcagagatccctgtggggcagtcagga
acactggctgtggatgtccagatgcagaacatgacactgagaggaccagatggggagccc
cagcctgggctggaaagccaaggcagagctgcctctatgccacgtctagcggcagaaaca
cagccggcccctaatgccagccccatgaagcgctccatctccacactggctccacgccca
catgggactcagctttgcagcacagttctggaccggcctcctcctagccaggcatcacat
caccaccaccaccgctgccaccggcgcagagacaagaagcaaaggtccctggaaaagggg
cccagcctgtctgttgacccagaaggtgcaccaagcactgctgcaggacctggcctgccc
catggagaaggatccaccggctgccggcgggaccgtaagcaggagcgaggccggtcccag
gagcggaggcagccctcgtcgtcttcttcagagaagcagcgcttctattcctgtgaccgc
tttgggagccgggagcccccgcaactgaagccctcactcagtagccaccccacatcgcca
acagcggcactagagccaggaccccacccacagggcagtggttccgttaatgggagcccc
ttgatgtcaacatccggtgctagcaccccgggccgaggtgggcggaggcagctcccccag
actcctctgaccccacgccccagcatcacctacaagaccgccaattcctcgcctgtccac
tttgctgagggtcagagcggcctcccagccttctcccctggccgtctcagccgcggcctt
tctgaacacaatgccctgctccagaaagagcccccgagccagcctctagctcctggctcc
cgaattggctctgatccttacctagggcagcgtctggacagtgaggcctccgcccacacc
ctgcctgaggatacactcacctttgaagaggcagtggccaccaactctggccgctcctcc
aggacttcctatgtgtcctccctcacttcccaatcccaccctctccgccgtgtacccaat
ggctatcactgcactttgggactcagcactggcgtccgggcgcggcacagctaccaccac
cccgaccaggaccactggtgctag

KEGG   Mus caroli (Ryukyu mouse): 110292269
Entry
110292269         CDS       T05910                                 

Gene name
Cacna1e
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110292269 (Cacna1e)
   04020 Calcium signaling pathway
    110292269 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110292269 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110292269 (Cacna1e)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110292269 (Cacna1e)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 110292269
NCBI-ProteinID: XP_021015151
Ensembl: MGP_CAROLIEiJ_G0014720
UniProt: A0A6P7R744
LinkDB
Position
1
AA seq 2316 aa
MARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVR
QNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTP
MSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTH
FNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIG
LEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAV
LTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERE
RVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSR
TEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFY
WIVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSS
FNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSS
MKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDW
NEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEE
EEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWE
QRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALG
LGLEKCEEERISRGGSLKGDIGGLTSALDNQRSPLSLGKREPPWLPRSCHGNCDPTQQEA
GGGETVVTFEDRARHRQSQRRSRHRRVRTEGKESASASRSRSASQERSLDEGVSIEGEKE
HEPHSSHRSKEPTIHEEERTQDLRRTNSLMVPRGSGLGGALDEAETPLVQPQPELEVGKD
AALTEQEAEGSSEQALLGDVQLDVGRGISQSEPDLSCMTANMDKATTESTSVTVAIPDVD
PLVDSTVVNISNKTDGEASPLKEAETKEEEEEAEKKKKQKKEKRETGKAMVPHSSMFIFS
TTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVF
TFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSL
RVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFY
CTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQV
LQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEC
SLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMM
KYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEI
ILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAML
FFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKG
CEPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPV
AEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPM
PKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKA
LPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQ
SSNHGIYLPPDTQEHAGSGRASSMPRLTMDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEF
SMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDV
SRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRR
QLPPVPPKPRPLLSYSSLMRHTGGISPPPDGSEGGSPLASQALESNSACLTESSNSLHPQ
QGQHPSPQHYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQ
MPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6951 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgttggcaggccaggctcaggcgatggagactcg
gaccagagcaggaaccgacaaggaacccccgtcccggcctcggggccggcggccgcctac
aagcagtcaaaagcgcagagggcgcggactatggctttgtacaaccccataccagtccgg
cagaactgtttcacggtcaacagatccctgttcatcttcggagaagataacattgtcagg
aaatacgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatc
attgccaactgcatcgtcttggccctggagcagcatcttcctgaggatgacaagacccca
atgtctcgaagactggagaagacagaaccatatttcattgggatcttctgctttgaagct
gggatcaaaattgtggctctagggttcatcttccataagggttcatacctccgtaatggc
tggaatgtcatggacttcatcgtggtccttagtggtatcctggccactgcgggaacccac
ttcaacacccacgtggacctgcggaccctccgggctgtgcgtgtcctgaggcctttaaag
ctggtatcaggaatacctagcctgcaaatcgtgctgaagtctatcatgaaggccatggtg
cctcttctgcagattggccttctgctcttctttgccatcctcatgtttgctatcattggc
ttggagttctacagtggcaagttgcatcgagcgtgcttcatgaacaattcaggtattcta
gaggggtttgatccccctcacccgtgtggtgtgcagggctgcccggctggttatgaatgt
aaggactggatcggccccaatgacgggatcacccagtttgacaacatcctttttgccgtg
ctgactgtcttccaatgcatcactatggaagggtggaccactgtgctgtacaataccaat
gatgccttaggagccacctggaactggctgtacttcatccccctcatcatcatcggatcc
ttcttcgttctcaacctcgtcctgggagtgctttccggggaatttgccaaagaaagagag
agagtggagaaccgaagagcattcatgaagctccggcgccagcaacagattgagcgagaa
ttgaatggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaat
aaaaactcgggaacatcagccttggaagtgcttcgaagggcaaccatcaaaaggagccgg
acggaggccatgacccgagactccagcgatgagcactgcgttgatatctcttcagtgggc
acacctcttgccagagccagtatcaagagcacaaaagtagacggagcctcctatttccgg
cacaaggaacggcttctgcgcatctctatccgccacatggtcaagtcccaagtcttttac
tggatcgtcctgagtgttgtggctcttaatactgcctgtgtggccattgttcatcacaac
cagccacaatggctcactcacctcctctactatgcagagtttttgtttctgggactcttc
ctgttggagatgtccctgaagatgtatggcatggggccacgcctctattttcactcatcc
ttcaactgctttgattttggggtcacagtgggcagcatctttgaggttgtctgggcaatc
ttcagacctggcacatctttcggaatcagtgtcttacgagctctccggctcctaaggata
tttaaaataaccaagtattgggcatccctccggaatctggttgtctccttgatgagctcc
atgaagtctatcatcagcttactcttcctcctcttcctcttcatcgttgtctttgctctc
ctgggaatgcagctctttggaggcaggtttaactttaatgatgggactccttcagctaat
tttgacaccttccctgcagctatcatgacagtgttccagatcctgaccggggaagactgg
aatgaggtgatgtacaatggcattcgctcccagggtggggtcagctcaggcatgtggtct
gccatctacttcattgtgctcaccttgtttggaaactacacgctgctgaatgtattcttg
gccattgctgtggataatctggccaatgcccaggaactgaccaaggatgagcaggaggaa
gaagaagccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtct
gctcccaacatgccttccattgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggaa
cagcgcaccagccagctgaggaggcacatgcaaatgtctagccaagaagccctcaacaaa
gaggaggccccgccaatgaaccccctcaatccactcaacccactgagtcctctcaacccc
ctcaatgctcaccccagcctctatcggaggcccaggcccattgagggtctagccctgggt
ctgggtcttgaaaagtgtgaagaggaacgcatcagtcgtgggggctccctcaaaggggac
atagggggcctgactagcgccctggacaaccagaggagccccttgtccttgggcaaacgg
gagccaccgtggctgcctagatcctgtcatggaaactgtgacccaacccagcaggaggct
gggggaggagagactgtggtgacttttgaggatcgggccaggcacaggcagagtcagagg
cgaagccggcatcgccgagtcagaactgagggcaaggagtctgcctctgcctcccgaagc
aggtctgccagccaagagcggagtctggatgaaggggtgtccattgagggggagaaggag
catgagcctcacagcagccacaggagcaaagagccgaccatccatgaagaggagagaacc
caggacttaaggaggaccaacagtctgatggtacccaggggctctggactgggaggggct
cttgatgaagcagaaacacctctagtccagccccaacctgagctggaagtggggaaggat
gcagctctgacagagcaggaggctgaaggcagcagtgaacaagcccttcttggggacgta
cagctggatgtgggccggggcattagccagagtgaaccagatctttcctgcatgacagcc
aacatggacaaggctaccacggagagcaccagtgtcacggtcgccatccctgatgtggac
cccttggtggactcaacagtggtgaacatcagcaacaagacggatggagaagccagtccc
ttgaaggaggcagagactaaagaggaagaagaagaggcagagaagaagaagaagcagaag
aaggagaagcgggagactggcaaagccatggtgccccatagctctatgttcatcttcagc
accactaatccgatccgcagggcctgccactacattgtgaacctccgctactttgaaatg
tgcattctcttggtgattgcggccagcagcattgccctggcagccgaggaccctgtacta
actaactcggagcgtaacaaagtcctgagatatttcgactatgttttcacgggagtgttt
acctttgaaatggttataaagatgatagaccaaggcttgatccttcaggatggatcatac
ttccgagacctctggaacatcctggactttgtggtagtggttggtgcattggttgcattt
gctctggcgaacgctttgggaaccaacaaggggagggatatcaagactatcaagtctctg
agggtgcttcgagttctgaggccactgaaaaccatcaagcgcttgcccaagctgaaggct
gtgtttgactgcgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaag
ctcttcatgttcatctttgccgtcatcgctgttcagctattcaaaggaaagttcttttat
tgcactgacagttccaaggacacagagaaggagtgcataggcaactatgtagaccatgag
aaaaacaagatggaggtaaagggccgggaatggaagcgtcatgaattccactatgacaac
atcatctgggccctgcttaccctcttcaccgtctcaacgggggaaggatggcctcaggtt
ctacagcactctgtagatgtgacagaggaggacagaggcccaagtcgcagcaaccgtatg
gagatgtccatcttttatgtggtctactttgtggtcttccctttcttctttgtcaatatc
ttcgtggctctcattatcatcaccttccaggagcaaggggacaagatgatggaggaatgt
agcctggagaagaatgagcgggcatgcattgacttcgccattagtgccaagcctctcacc
cgctacatgccacagaacagacacaccttccagtaccgtgtgtggcactttgtagtctcc
ccatcctttgagtataccatcatggccatgattgccttgaacactgtcgtgctgatgatg
aagtactactctgctccttgcacctatgagctcgccctaaagtacctgaacatcgccttc
actatggtgttttccctggagtgtgtcctaaaggtcatcgctttcggcttcctgaactac
ttccgagatacctggaacatctttgacttcatcacggtgatcggcagtatcacagaaatt
atcctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctc
ttccgagctgcacggctcataaagcttctgagacagggctacaccatccgcatcttactg
tggaccttcgtgcagtcctttaaggctcttccttatgtctgccttctgattgccatgctt
ttcttcatctacgccatcattgggatgcaggtgtttggaaacatcaagttagatgaggag
agtcacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgcttttc
aggagtgccacaggggaggcttggcaggagattatgctgtcctgtctcggtgagaagggc
tgcgagcctgacaccaccgcaccctcagggcagaatgagagtgagcgctgtggcaccgac
ctggcctacgtttattttgtctccttcatcttcttctgctccttcctgatgctcaacctg
ttcgtggctgtcatcatggacaactttgagtacctgactcgagattcctccatcctgggg
cctcaccacttagatgaatttgtccgtgtctgggcagaatatgacagagcagcatgtggc
cgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctc
ggcaagagatgtccctccaaagtggcctataagaggttggtcctgatgaacatgccagtg
gctgaggacatgacagtccacttcacctccacacttatggctctgatccggacagctctg
gacattaaaatcgccaaaggtggtgcagacagacagcagctagactcagagcttcaaaaa
gagaccctggccatttggcctcacctgtcccaaaagatgttggatctgctagtgcccatg
cccaaagcctctgacctgactgtgggcaagatctatgcagcaatgatgatcatggactac
tataaacagagtaaggtaaagaaacagagacagcagctggaagaacagaaaaatgcaccc
atgttccagcgcatggagccctcatcactgcctcaggagatcattgctaatgccaaagcc
ctgccttatctccagcaggaccctgtttctggcctgagtggtcggagtggatacccttca
atgagtccactctcccctcaagaaatattccagttggcttgtatggacccagcggatgat
gggcaattccaggaacaacaatctctggagccagaggttagtgaattaaaaagtgtgcag
tcctctaaccatggcatctaccttcctccggacacccaggagcatgcgggatctgggagg
gcatcctctatgccacgtctgactatggatccccaggtggtaacagaccctagctctatg
cgacgttcattttctacaattcgggataagcgttcaaattcctcctggttggaggagttc
tccatggaacgcagcagtgaaaacacttacaagtcacggcgcagaagttaccactcctcc
ctgaggctgtcagcacaccgcctgaattctgactccggtcacaagtctgacactcaccgc
tcaggaggcagggagagaggccgatccaaagaacgaaagcacctcctctctccggatgtc
tcccgctgcaattctgaggagcgagggacccaggctgactgggagtccccagaacgtcgc
cagtccaggtcacccagtgaaggaaggtcacagacccccaacagacagggtactggttcc
ctaagtgagagctccatcccctctatttccgacaccagcaccccaagacgaagccgtcgc
cagctcccacctgtgccaccaaagcctcgtcccctcctctcctacagctccctgatgaga
cacactggcggcatctctccacctcctgatggaagtgagggtggatccccactggcctct
caagctctggagagcaacagcgcttgcctgaccgagtcttccaactccttgcacccccag
cagggtcagcatccttccccacagcactacatctccgagccctatctggccctccatgaa
gactcccacgcctcagactgtggcgaggaggagacactcacctttgaggcagccgtagcc
actagcttgggccgatccaataccattggctctgcgccacccctacggcacagctggcag
atgcctaatgggcactatcggcggcggaggcgtggggggcctgggcctggcatgatgtgt
ggagctgtcagtgacctcctgagtgacacggaagaagacgataagtgctag

KEGG   Mus caroli (Ryukyu mouse): 110295755
Entry
110295755         CDS       T05910                                 

Gene name
Cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04260  Cardiac muscle contraction
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04713  Circadian entrainment
mcal04720  Long-term potentiation
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04742  Taste transduction
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05031  Amphetamine addiction
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110295755 (Cacna1c)
   04020 Calcium signaling pathway
    110295755 (Cacna1c)
   04024 cAMP signaling pathway
    110295755 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    110295755 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110295755 (Cacna1c)
   04929 GnRH secretion
    110295755 (Cacna1c)
   04912 GnRH signaling pathway
    110295755 (Cacna1c)
   04921 Oxytocin signaling pathway
    110295755 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    110295755 (Cacna1c)
   04924 Renin secretion
    110295755 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    110295755 (Cacna1c)
   04927 Cortisol synthesis and secretion
    110295755 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110295755 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    110295755 (Cacna1c)
   04270 Vascular smooth muscle contraction
    110295755 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    110295755 (Cacna1c)
   04727 GABAergic synapse
    110295755 (Cacna1c)
   04725 Cholinergic synapse
    110295755 (Cacna1c)
   04728 Dopaminergic synapse
    110295755 (Cacna1c)
   04726 Serotonergic synapse
    110295755 (Cacna1c)
   04720 Long-term potentiation
    110295755 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    110295755 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    110295755 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110295755 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110295755 (Cacna1c)
   05020 Prion disease
    110295755 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    110295755 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    110295755 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110295755 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110295755 (Cacna1c)
   05414 Dilated cardiomyopathy
    110295755 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110295755 (Cacna1c)
   04934 Cushing syndrome
    110295755 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110295755 (Cacna1c)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110295755 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH Etmic-2 PKD_channel DUF4834
Other DBs
NCBI-GeneID: 110295755
NCBI-ProteinID: XP_021019807
Ensembl: MGP_CAROLIEiJ_G0028788
LinkDB
Position
6
AA seq 2093 aa
MIRAFVQPSTPPYQPLSSHTSEETERKFKGKVVHEAQLNCFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGGTTATRPPRALLCLTLKNPIRRACISIVEWKSFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEDKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAANHGLSVFRSLMDCRM
RLQGSDAADTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVET
KIMSPLGISVLRCVRLLRIFKITRYAHSYTNLLCEIPIINTLLAIGNLLLLLFLFIIIFS
LLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPG
MLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEK
KQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPREEDEEEPEMPVGPRPRP
LSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAED
PVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSL
ISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQF
MFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNV
LAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIF
VGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYF
EYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSD
PWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLS
RGEGIRTLLWTFIKSFQEXRGKEGTTFLXTGERVDYSTIISNTEVAFSNLPSLAQELWLS
DAQFLLVIPPERCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISF
YMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVT
LLRRIXPPXGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLE
QANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGL
VGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRA
GGLFGNHVTYYQSDSRGNFPQTFATQRPLHINKTGNNQADTESPSHEKLVDSTFTPSSYS
STGSNANINNANNTALGRFPHPAGYSSTVSTVEGHGPPLSPAVRVQEAAWKLNSKRCHSR
ESQGATVSQEMFPDETRSVRMSEEAEYCSEPSLLSTDMLSYQEDEHRQLTCPEEDKREIQ
PSPKRSFLRSASLGKLTPRFAALAVAGLSPLLQRSHSPTTFPRPCPTPPVTPGSRGRPLR
PIPTLRLEGAESSEKLNSSXPSIHCSSWSEETTACSGXSSMARRARPVSLTVPSQAGAPG
RQFHGSASSLVEAVLISEGLGQFAQDPKFIXVTTQELADACDMTIEEMENAADNILSGGA
QQSPNGTLLPFVNCRDPGQDRAVVPEDESCAYALGRGRSEEALADSRSYVSNL
NT seq 6282 nt   +upstreamnt  +downstreamnt
atgattcgggccttcgttcagccatccacacccccataccagccnctctccagtcacacg
tctgaggaaacagagaggaagttcaagggcaaggtggtacatgaagctcaactcaactgt
ttctacatttctcctggaggttccaactatgggagcccacgcccagctcatgccaacatg
aatgccaatgcagctgcaggacttgctcccgagcacatccctactccaggggcagcactg
tcctggcaggcagccatcgatgccgcccggcaggccaagctcatgggcagtgctggcaac
gcaaccatctctaccgtcagttccacacagcggaagcggcagcagtatgggaaacccaag
aagcaggggggcacaacagccacacggccgccccgggctctgctctgcctgactctgaag
aaccctatccggagggcgtgcataagcattgttgaatggaaatcatttgaaatcattatt
ttactgactatttttgccaattgtgtggccttagcaatctatattccctttccggaagac
gactccaacgccaccaactccaacctggaacgagtggagtatctcttcctcatcattttt
accgtggaagcatttttaaaagtaattgcctacggacttctcttccaccccaacgcatac
ctccgcaacggttggaatttactggattttataattgtggttgtagggctttttagtgca
attttagaacaagcaaccaaagctgatggggccaatgctctaggagggaaaggagctgga
tttgacgtgaaggcactgagagcattccgcgtgctccgtcccctgcgactggtgtccgga
gtcccaagtctccaggtggtcctgaactccatcatcaaggccatggtgcctctgctgcac
atcgctcttcttgtgctcttcgtcatcatcatttatgctattatcggcctggagctcttc
atgggaaagatgcacaagacctgctacaaccaggagggcataatagatgttccagcagaa
gaggacccttccccttgtgctttggagacaggccatgggcgacagtgtcagaacgggacc
gtgtgcaaacctgggtgggatgggcccaagcacggcatcaccaacttcgacaacttcgcc
ttcgccatgctgacggtgttccagtgtatcaccatggagggctggacagacgtgctgtac
tggatgcaagacgctatgggctatgagttgccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgttttgagcggggagttttccaaa
gagagggagaaagccaaagcccgaggagatttccagaagcttcgagagaaacagcagcta
gaagaagatctcaaaggctacctggactggatcacccaggcagaagacattgaccctgag
aacgaggacgagggcatggatgaagacaagcctcgaaacatgagcatgcccacaagtgag
actgagtctgtcaacactgaaaacgtggctggaggtgacatcgagggagaaaactgtgga
gccaggcttgccgccaatcacggtctatcagtgttccgttcacttatggactgcagaatg
aggttgcaggggtctgatgctgcagacacagccaataaagccctcctggcccttttcact
gcagaaatgctcctgaagatgtacagcctgggtctgcaggcctattttgtgtccctcttc
aaccgctttgactgtttcattgtgtgtgggggcatcctggagaccatcctggtggagacg
aagatcatgtctcccctgggcatctctgtgctgagatgtgtgcggttgctcaggatcttc
aagatcaccaggtatgcacactcatacacaaacttactgtgtgaaattccgattataaac
actctcctagcgataggcaacttgctgctgctcctcttcctcttcatcatcatcttctcc
ctcctggggatgcagctctttggagggaagttcaacttcgatgagatgcagacccgtagg
agcacgttcgataacttcccgcagtctctcctcactgtgtttcagatcctgaccggggag
gactggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggg
atgttagtctgtatttacttcatcatcctcttcatctgtggaaattatatcctactgaat
gtgttcttggccattgcggtggacaacctggctgatgcggagagcctgacctcagcccaa
aaggaggaggaagaagagaaggagaggaagaagctggccaggactgccagcccagaaaag
aaacaggaggtgatggagaagccagccgtggaggaaagcaaagaggagaaaattgaactg
aagtccattacagcagatggagaatccccacccactaccaagatcaacatggatgacctc
cagcccagggaagaggatgaagaggagccagagatgcctgtggggccacgcccccggcca
ctgtctgagctgcaccttaaggaaaaggcagttcccatgccggaagccagtgcatttttc
atcttcagcccaaacaacaggttccgcctgcagtgccaccgtattgtcaatgacacgatc
ttcaccaacctcatcctcttcttcattctgctcagcagcatctctctggctgctgaggac
cccgtccagcacacctccttcaggaaccatatcctaggcaatgcagactatgtcttcact
agtatctttacattagaaattatccttaagatgactgcttacggggctttcctgcacaag
ggctctttctgccgaaattacttcaatatcctggacctgctggtggttagcgtgtccctc
atctcctttggcatccagtccagcgcaatcaacgttgtgaagattttacgagtgctgcga
gtccttagacccctgagggccatcaacagggccaaggggctaaagcatgtggttcagtgc
gtgtttgtggccatccggaccatcgggaacatcgtaattgtcaccactctgctgcagttc
atgtttgcctgcattggggtccagctcttcaagggaaagctctatacctgttcggatagt
tctaaacagacggaggcagaatgcaagggtaactatatcacatacaaagatggagaggtt
gatcaccccattatccagcctcgaagctgggagaacagcaagtttgactttgacaatgtt
ttggcagccatgatggctctcttcaccgtctccaccttcgaagggtggccagagctgctg
taccgctccattgactcccacacagaagacaagggccccatctacaactaccgtgtggag
atctccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaacatcttc
gtgggtttcgtcattgtcaccttccaggagcagggggaacaagagtacaagaactgtgag
ctggacaagaaccagagacaatgtgtggaatatgccctcaaggcccgacccttgcgaagg
tacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactctacctacttc
gagtatctgatgttcgttctcatcctgctcaacaccatctgcctggccatgcagcactat
ggccagagctgcctcttcaaaatcgccatgaatatactcaacatgcttttcaccggcctc
ttcacggtggagatgatcctgaagctcattgccttcaaacccaagggttactttagtgat
ccctggaatgtttttgacttcctcatcgtcattgggagcataattgatgtcattctcagt
gagactaatccagctgaacatacccaatgctctccctctatgagtgcagaggagaactcc
cgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtgaagctgctgagc
cgcggggaaggcatccgaaccctgctgtggaccttcatcaagtccttccaggaggngcgt
gggaaggaagggacaaccttcctgnttactggagaacgtgtggactactccaccatcatc
tcaaacaccgaagtcgcgttcagcaacctcccnagtctcgcacaggaactctggctgtca
gatgctcagttccttttggtaattcctcctgaaaggtgtgccaccggagaggcctggcag
gacatcatgctggcctgcatgccaggcaagaagtgtgccccagagtctgagccnagcaac
agcacggaaggggagaccccctgtggcagcagctttgctgtcttctacttcatcagcttc
tacatgctctgtgccttcctgatcatcaacctctttgtagcngttatcatggacaacttt
gactacctgactagggattggtctatcctcggtccccatcacctggatgaattcaagaga
atctgggccgagtatgaccctgaagccaagggtcggatcaaacacttggatgtggtgacc
ctcctccgtcgaattcancccccantgggttttgggaagttgtgtcctcaccgtgtggcc
tgcaaacgcctggtgtccatgaacatgcctctgaacagtgatggcacagtcatgttcaat
gctaccctgtttgccctcgtcaggacagccctgaggatcaaaacagaagggaacctagag
caagccaatgaggagctccgggccatcatcaagaaaatctggaagaggaccagcatgaag
ctgttggaccaggtggtgccccctgcaggcgatgacgaggtcacagtgggcaagttctat
gccaccttcctgatccaagagtacttcaggaaattcaagaagcgaaaagagcaggggctg
gtgggcaagccctcacaaaggaatgcactgtccctccaggctggcttacgcaccttgcat
gacattgggcctgagatccggcgggccatctctggggatctgactgctgaggaggaattg
gacaaggctatgaaggaggcggtgtctgctgcctccgaagacgacatcttcaggagggct
ggaggcctgttcggcaaccatgtcacctactatcagagtgacagcaggggcaacttccct
cagacattcgccacccagcgcccactgcacatcaacaagacagggaacaaccaagctgac
accgagtcaccgtcccatgagaagctggtggactccacgttcacccccagcagctactca
tccacaggctccaatgccaacatcaacaatgccaacaacactgccctgggccgcttcccc
catcccgctggctactccagcactgtcagcaccgtggagggccatgggcctcccttgtcc
cctgctgtccgagtacaggaggcagcatggaagctcaactctaagaggtgccactcccga
gagagccagggagccacggtgagtcaggagatgtttccagatgagacccgcagcgtgagg
atgagtgaagaagccgagtactgcagtgagcccagcctgctctctacagatatgctgtcc
taccaggaggatgaacaccgacaactgacctgcccagaggaggacaagagggagatccag
ccatctccaaagaggagtttccttcgctctgcctctctaggtaaactcacgcctcgcttt
gcagcattggcagtggcaggcttgagccccctcctgcagagaagccattctcctaccaca
ttccccaggccgtgccccacaccccctgtcactccaggcagccggggcaggcccctacgt
cccatccctaccctacggctggagggggcagagtccagcgagaaactcaacagcagctnc
ccatccatccactgtagctcctggtctgaggagactacagcctgtagtgggancagcagc
atggcccggagagcccggcccgtctccctcaccgtgcccagccaggctggagctccaggg
agacagttccatggcagtgccagcagcctggtngaagcggtcttgatttcagaaggactg
ggacagtttgctcaagatcccaagttcatcnaggtcaccacccaggagctggctgacgcc
tgcgacatgacaatagaggagatggagaacgccgcagacaacatcctcagtgggggcgcc
cagcagagccccaacggcaccctcttaccttttgtgaactgcagggacccggggcaggac
agggctgtggtcccagaggacgagagctgcgcatatgccctggggcgaggccggagcgag
gaggcgctcgcggacagcaggtcctacgtcagcaacctgtag

KEGG   Mus caroli (Ryukyu mouse): 110299941
Entry
110299941         CDS       T05910                                 

Gene name
Cacna1a
Definition
(RefSeq) voltage-dependent P/Q-type calcium channel subunit alpha-1A isoform X1
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04721  Synaptic vesicle cycle
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04742  Taste transduction
mcal04930  Type II diabetes mellitus
mcal05017  Spinocerebellar ataxia
mcal05032  Morphine addiction
mcal05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110299941 (Cacna1a)
   04020 Calcium signaling pathway
    110299941 (Cacna1a)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    110299941 (Cacna1a)
   04727 GABAergic synapse
    110299941 (Cacna1a)
   04725 Cholinergic synapse
    110299941 (Cacna1a)
   04728 Dopaminergic synapse
    110299941 (Cacna1a)
   04726 Serotonergic synapse
    110299941 (Cacna1a)
   04730 Long-term depression
    110299941 (Cacna1a)
   04723 Retrograde endocannabinoid signaling
    110299941 (Cacna1a)
   04721 Synaptic vesicle cycle
    110299941 (Cacna1a)
  09157 Sensory system
   04742 Taste transduction
    110299941 (Cacna1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110299941 (Cacna1a)
  09165 Substance dependence
   05032 Morphine addiction
    110299941 (Cacna1a)
   05033 Nicotine addiction
    110299941 (Cacna1a)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110299941 (Cacna1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110299941 (Cacna1a)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110299941 (Cacna1a)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel DUF2207
Other DBs
NCBI-GeneID: 110299941
NCBI-ProteinID: XP_021025573
Ensembl: MGP_CAROLIEiJ_G0031301
LinkDB
Position
8
AA seq 2369 aa
MARFGDEMPGRYGAGGGGSGPAAGVVVGAAGGRGAGGSRQGGQPGAQRMYKQSMAQRART
MALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALE
QHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIVALGFAFHKGSYLRNGWNVMDFVVVL
TGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAIL
IFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
TQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDVEQRHPFD
GNSLRRATLKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMR
FYIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIK
MYGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYW
ASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAA
IMTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNL
ANAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPTKSVWEQ
RTSEMRKQNLLASREALYGDAAERWPTPYARPLRPDVKTHLDRPLVVDPQENRNNNTNKS
RAPEALRPTARPRESARDPDARRAWPGSPERAPGREGPYGRESEPQQREHAPPREHAPWD
ADTERAKAGDAPRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERRPRPRDATRPARAADG
EGDDGERKRRHRHGPPAHDDRERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDLPL
AEDLDNMKNNKLATGEPASPHDSLGHSGLPPSPAKIGNSTNPGPALATNPQNAASRRTPN
NPGNPSNPGPPKTPENSLIVTNPSSTQPNSAKTARKPEHMAVEIPPACPPLNHTVVQVNK
NANPDPLPKKEEEKKEEEEADPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEM
CILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAY
FRDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFD
CVVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFERDCRGKYLLYEKNE
VKARDREWKKYEFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMS
IFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHM
PQNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSL
FSLECVLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARL
IKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDGEDEDSDE
DEFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTADCGNEFAY
FYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIH
YKDMYSLLRVISPPLGLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIK
IAKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQ
SKAKKLQAMREEQNRTPLMFQRMEPPSPTQEGGPSQNALPSTQLDPGGGLMAHESSMKES
PSWVTQRAQEMFQKTGTWSPERGPPIDMPNSQPNSQSVEMREMGTDGYSDSEHYLPMEGQ
TRAASMPRLPAENQRRRGRPRGNDLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEE
NQRYHQRRRDRGHRTSERSLGRYTDVDTGLGTDLSMTTQSGDLPSKDRDQDRGRPKDRKH
RPHHHHHHHHHHPPAPDRDRYAQERPDTGRARAREQRWSRSPSEGREHTTHRQGSSSVSG
SPAPSTSGTSTPRRGRRQLPQTPCTPRPLVSYSPAPRRPAARRMAGPAAPPGGSPRGCRR
APRWPAHAPEGPRPRGADYTEPDSPREPPGGAHDPAPRSPRTPRAAGCASPRHGRRLPNG
YYAGHGAPRPRTARRGAHDAYSESEDDWC
NT seq 7110 nt   +upstreamnt  +downstreamnt
atggcccgctttggagacgagatgccgggccgctacggcgcaggcggaggaggctcaggg
ccggccgccggggtggtcgtgggcgccgcgggcggccgaggagccgggggcagccggcag
ggcgggcagcccggagcgcagaggatgtacaagcagtcgatggcgcagagagcgcggacc
atggccctctacaaccccatccctgtccgccagaactgcctcacggtcaaccgctccctg
ttcctcttcagtgaagacaacgtggtgagaaaatacgccaaaaagatcacggaatggcct
cccttcgagtacatgatcctggccaccatcattgctaactgcatcgtcctggccctggag
cagcacctccctgatgacgacaagacacccatgtctgagcggctggatgacacagaacca
tacttcattggaatcttctgttttgaggctggaattaagatcgtggctcttggctttgcc
ttccacaaaggctcctacctgaggaatggctggaacgtcatggactttgtcgtggtgcta
acaggcatcttggccactgtcgggacggagtttgacctacggacactgagggcggttcgt
gtgctgcggccactcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtca
atcatgaaggcgatgatccctctgctgcagattggcctcctcctgttttttgcaatcctt
atttttgcaatcatagggttagaattttatatggggaaatttcataccacctgctttgaa
gaggggacagacgacatccagggtgagtcgccagctccgtgtgggacagaggagcctgcc
cgcacctgccccaacgggaccaaatgtcagccgtactgggaagggcccaacaacggcatc
actcagttcgacaacatcctgtttgctgtgctcactgttttccagtgcatcaccatggaa
ggctggactgatctcctctacaatagcaacgatgcctcagggaacacttggaactggttg
tacttcatccccctcatcatcatcggctccttttttatgctgaaccttgttctgggtgtg
ctgtctggggagtttgccaaagaaagggaacgggtggagaaccggagagcttttctgaag
ctcagaagacaacaacagattgaacgtgagctcaatggatacatggagtggatctcaaaa
gcagaagaggtgattcttgcggaggacgagacagacgtggagcagaggcacccttttgat
ggtaactctcttcggagagctactctgaagaaaagtaagacggacctgctcaaccctgag
gaggccgaggaccagctggccgacatcgcgtctgtggggtctcccttcgccagagccagc
atcaaaagtgccaagctggagaactcgactttttttcacaagaaggagagaagaatgcgt
ttctacatccgccgcatggtcaaaactcaggccttctactggaccgtgctcagtctggta
gccctcaacacgctgtgcgtcgccattgtccactacaaccagcccgagtggctctccgac
ttcctctactatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaa
atgtacgggctcgggacgcggccttacttccactcttccttcaactgctttgactgtggg
gtcatcattgggagcatctttgaagtcatctgggctgtcatcaaacctggtacatccttt
ggaatcagcgtgttacgagctctcaggttactgcgaattttcaaagtcacaaagtactgg
gcatctctcagaaacctggttgtctccctcctcaactccatgaagtccatcataagtctg
ttgttcctcctctttctgttcatcgttgtctttgccctcctggggatgcagctgttcggt
ggccagtttaattttgatgaggggactcctcccaccaactttgacacttttccagcagca
ataatgactgtgtttcagatcctgactggcgaggattggaatgaggtcatgtatgatggg
atcaagtctcaggggggcgtgcagggcggcatggtgttctccatctacttcatcgtcctc
accctcttcgggaactacaccctgctgaacgtgttcttggccatcgcagtggacaacctg
gccaatgcccaggagctcaccaaggatgagcaagaagaggaagaggcagccaatcagaag
ctggctctacagaaagccaaggaggtagcagaagtgagtcccctgtctgcagccaacatg
tccatagccgtgaaggagcagcagaagaaccagaagcctaccaagtcggtgtgggagcag
cgcaccagcgagatgcgcaagcagaacctgctggccagccgcgaggcgctgtacggggac
gcggctgagcgctggcccaccccctacgcgcgcccgctgcggcccgacgtgaagactcac
ttggaccggccgcttgtggtggacccgcaggagaaccgtaacaacaacaccaacaagagc
cgtgcgccggaagcgctgcgcccgacagcgcggccccgcgagagcgcgcgcgaccccgac
gcgcggcgcgcctggcccggcagccctgagcgcgcccctggacgagagggcccgtatggc
cgcgagagcgagccgcagcagcgcgagcacgcgccgccccgcgagcacgcaccctgggac
gcggacaccgagcgcgccaaagccggggacgcgccccgccgccacacgcaccgacctgtg
gcggagggcgagcctcgccgccaccgcgcccgccgccggccgggggacgaacccgacgac
aggccagagcgcaggccgcgtccccgcgacgccactaggccggcccgcgctgcagacggc
gaaggcgacgatggggagcgcaagcggagacaccgacacgggccgcccgcccacgacgac
agggagcgcagacaccggcgcagaaaagagaaccagggctctggggtccccgtgtctggt
cccaacctgtccaccaccaggccaatccagcaggacctgggccgccaggacctgccgctg
gctgaggatcttgacaacatgaagaataacaagctggccaccggggaacctgccagtccc
cacgacagcctgggccacagcggccttccccccagccccgccaaaatcgggaacagcacc
aaccctggtcccgccttggccaccaatccccagaacgctgccagccgcaggacgcccaac
aacccgggcaacccgtccaaccccggcccccccaagactcccgagaacagccttatcgtc
accaaccccagcagcacccagcccaactcagcgaagactgccaggaaacccgagcacatg
gcggtggagatccccccagcctgcccgcccctcaaccacaccgtggtccaagtaaacaaa
aacgccaacccagacccactgccaaagaaagaggaagagaagaaggaggaagaggaggca
gaccccggggaggacggcccaaagcccatgccgccctacagctccatgttcatcctctcc
accaccaacccccttcgccggctgtgccattacatcctgaacctgcgctacttcgagatg
tgcatcctcatggtcattgccatgagcagcatcgctctggccgccgaggacccggtgcag
cccaacgcaccccgcaacaatgtgctgcgatattttgactatgtttttacaggcgtgttt
acctttgagatggtgatcaagatgatcgacctgggcctcgtcttgcatcagggggcctat
ttccgtgacctatggaacattctggacttcatagtggtcagtggggccctggtggccttt
gccttcactggcaatagcaaaggaaaggacattaacaccattaagtctctccgagtcctc
cgggtgctacggcctctaaaaaccatcaagcggctgccgaagctgaaggccgtgtttgac
tgcgtagtgaactcgctcaagaacgtcttcaacatcctcattgtgtacatgctgttcatg
ttcatcttcgctgtggtggccgtgcagctcttcaagggcaagttcttccactgcacggac
gagtccaaggagttcgagagagactgtcgaggcaagtacctcctgtacgagaagaacgaa
gtgaaggcccgagaccgcgagtggaagaagtacgagttccactacgacaacgtgctctgg
gctctgctcacgcttttcacagtgtccacgggagagggctggccacaggtcctcaagcac
tcagtggatgctacttttgagaaccagggccccagccccgggtaccgcatggagatgtcc
atcttctacgtggtgtactttgtagtgtttcccttcttctttgtcaatatcttcgtggcc
ttgatcatcatcacctttcaggagcagggagacaagatgatggaagagtacagcctggag
aaaaatgagagggcctgcatcgactttgccatcagtgccaagccgctgaccaggcacatg
ccccagaacaagcagagcttccagtatcgaatgtggcagttcgtcgtgtccccacccttt
gagtacaccatcatggccatgatcgctctcaacaccatcgtgctaatgatgaagttctac
ggagcctcggtggcctatgaaaacgcccttcgcgtgttcaacattgtcttcacctccctc
ttctctctcgaatgtgtgctcaaagtcatggcttttgggattctgaattatttccgcgat
gcctggaacatcttcgactttgtgactgttctgggcagcatcacagacatcctcgtcacc
gagtttgggaataacttcatcaacctgagctttctccgcctcttccgtgctgccagactc
atcaaactcctccgccagggttacaccatccgcattctcctctggactttcgtgcagtcc
ttcaaggccctaccttatgtctgtctgctgatcgccatgctcttcttcatctacgccatc
atcgggatgcaggtgtttggcaacatcggcattgacggggaggacgaggacagcgacgag
gatgaattccaaatcacagagcacaataacttccggaccttcttccaagcgctcatgctt
ctcttccggagcgccacaggagaagcgtggcacaacatcatgctctcctgcctcagtggg
aagccatgcgataagaactccgggatcctcacagcagactgtggcaacgagttcgcgtac
ttctactttgtctcgttcatcttcctgtgctcgtttctgatgctgaatctctttgtcgct
gtcatcatggacaacttcgagtacctcacccgagattcttccatcctgggcccccaccac
ttggatgaatacgtgcgtgtctgggcagagtatgaccctgctgcctgcggccgcattcac
tataaggacatgtacagtttattgcgagtaatatcgccccctctcggcttaggcaagaaa
tgtcctcatagggttgcttgcaagagactcctgcggatggacctgccggtagcagatgac
aacacagttcacttcaactccaccctgatggctctaatccgaactgccctggatatcaaa
attgccaagggtggagctgacaagcagcagatggatgcagagcttcgcaaggagatgatg
gccatttggcccaacctgtctcagaagaccctagatctgctggtcacacctcacaagtcc
acggacctgacagtgggtaagatctacgcagccatgatgatcatggagtattaccggcag
agcaaggccaagaaactgcaggccatgcgagaggagcagaaccggacaccactcatgttc
cagcgcatggagcctccatcaccaacacaggagggaggacccagccagaacgcccttccc
tccactcagctggacccaggaggaggcctgatggctcacgaaagcagcatgaaggagagc
ccatcctgggtgacccagcgggcccaagagatgttccagaagactggcacctggagccca
gagcgagggccacccatcgacatgcctaacagccagcccaactcccagtctgtggagatg
cgagaaatgggtactgatggctactcagacagcgaacactacctccccatggaaggccag
accagggctgcttccatgccccgcctcccagcagagaaccagaggagaaggggccggcca
cgtggaaatgacctcagtaccatctctgataccagccccatgaagcgctcagcttctgtg
ctgggacccaaagcccggcgactggatgactactcactagagcgggtaccgcctgaggag
aaccaacggtaccaccaacgtcgccgggaccgtggccaccgcacctctgagcgctctctg
ggccgatacactgatgtggacacaggtttggggacagatctgagcatgaccacccaatcg
ggtgacctgccctccaaagatcgggaccaggaccggggccgacccaaggaccggaagcat
cggccacaccaccaccaccaccaccatcatcatcatcccccggcccccgaccgggatcgc
tacgcacaggagcggccggacaccggccgggcgcgggcccgggagcagcgctggtcccgc
tcgcccagcgaaggtcgggagcacacgacacacagacagggcagtagttccgtcagtgga
agcccagccccctctacgtccggcaccagcacgccgcggcgcggccgccgccagctcccc
cagaccccctgcaccccgcggccgcttgtgtcctactcgcccgctccgcgcaggcctgcg
gcgcgcaggatggcgggtcccgcagcgccccctggcggctcgccgcggggttgccgccgt
gcgccgcgctggcctgcgcatgcgcctgagggcccgcggccgcgcggcgctgactacacc
gagcccgacagtccgcgcgagccgccagggggcgcgcacgatcccgcgccgcggtcgccc
aggactccgcgcgccgcgggctgcgcgtcaccgcgccacggccgcaggctgcccaatggt
tactacgcggggcacggcgcgccgcggccgcgcacagcccgcaggggcgcgcacgacgcg
tacagcgagagcgaggacgactggtgctaa

KEGG   Mus caroli (Ryukyu mouse): 110304549
Entry
110304549         CDS       T05910                                 

Gene name
Cacna1g
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1G
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04713  Circadian entrainment
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110304549 (Cacna1g)
   04020 Calcium signaling pathway
    110304549 (Cacna1g)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    110304549 (Cacna1g)
   04925 Aldosterone synthesis and secretion
    110304549 (Cacna1g)
   04927 Cortisol synthesis and secretion
    110304549 (Cacna1g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110304549 (Cacna1g)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110304549 (Cacna1g)
   04934 Cushing syndrome
    110304549 (Cacna1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110304549 (Cacna1g)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110304549 (Cacna1g)
SSDB
Motif
Pfam: Ion_trans PKD_channel SieB
Other DBs
NCBI-GeneID: 110304549
NCBI-ProteinID: XP_021031605
Ensembl: MGP_CAROLIEiJ_G0016980
UniProt: A0A6P5QSF9
LinkDB
Position
11
AA seq 2358 aa
MDEEEDGAGAEESGQPRSFTQLNDLSGAGGRQGPGSTEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERVSMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLEPYYQTENEDESPFICSQPRENGMRSCRSVPTLRGEGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAVGVRAGLLSSPVARGGQEPQPSG
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRVPRASPEIQDRDANGSRWLMLPPPSTP
TPSGGPPRGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
MLKDKALVEVAPSPGPPTLTSFNIPPGPFSSMHKLLETQSTGACHSSCKISSPCSKADSG
ACGPDSCPYCARTGAGEPESADHEMPDSDSEAVYEFTQDAQHSDLRDPHRRRRRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEIGKREDTSGQLSCIQLPVNSQGGDATKSESEPDFFSPSVDGDGDRKKRL
ALVALGEHAELRKSLLPPLIIHTAATPMSLPKSSSTGVGEALGSGSRRTSSSGSAEPGAA
HHEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQES
QDEEESSEEDRASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRSSASEHQDC
NGKSASGRLARTLRTDDPPLDGDDGDDEGNLSKGERLRAWVRARLPACCRERDSWSAYIF
PPQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAVVALGWCFGEQAYL
RSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLRVISRAQGLKLVV
ETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW
VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL
IVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLKRLEKKRRNLMLDDVIASGSSA
SAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQILDEA
LKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITLEEIEVNASLP
INPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFMLLFFIFAALGV
ELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKDTLRDCDQESTCY
NTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEAELELEMKTLSPQP
HSPLGSPFLWPGVEGVNSPDSPKPGAPHTMAHIGAASSGFSLEHPTDRQLFDTISLLIQG
SLEGELKLMDELAGPGGQPSAFPSAPSPGDSDPQIPLAEMEALSLTSEIVSEPSCSLALT
DDSLPDDTHTLLLSALESNMVPHTEEGPVPLGPDLLTVRKSGVSRTHSLPNDSYMCRNGS
TAERSLGHRGWGLPKAQSGSILSVHSQPADTSCILQLPKDAYYLLQPHGAPTWGAIPKLP
PPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLSEVSGPSCPLTRSSSFWGGSSIQVQ
QRSGSQSKVSKHIRLPAPCPGLEPGWAKDPQETRSSLELDTELSWISGDLLPSSQEEPLS
PRDLKKCYSVEAQSCRRRPGSWLDEQRRHSIAVSCLDSGSQPRLCPSPSSLGGQPLGGPG
SRPKKKLSPPSISIDPPESQGPRPPCSPGVCLRRRAPASDSKDPSASSPLDSTAASPSPK
KDALSLSGLSSDPTDLDP
NT seq 7077 nt   +upstreamnt  +downstreamnt
atggatgaggaggaggatggagcgggcgccgaggagtcgggacagccccggagcttcacg
cagctcaacgacctgtctggggccgggggccgacaggggccggggtcgacggaaaaggac
ccgggcagcgcggactccgaggcggaggggctgccctacccggcgctggccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccgcacggtctgtaac
ccgtggttcgagcgagtcagcatgctggtcattctcctcaactgtgtgactctgggtatg
ttcaggccgtgtgaggacattgcctgtgactcccaacgctgccggatcctgcaggccttc
gatgacttcatctttgccttctttgctgtggaaatggtggtgaagatggtcgccttgggt
atctttgggaagaaatgttacctgggagacacttggaaccggcttgacttttttatcgtc
attgctgggatgctggagtactcgctggacctgcagaatgtcagcttctccgcagtcagg
acagtccgtgtgctgcgaccgctcagggccattaaccgggtgcccagcatgcgcattctc
gtcacattactgctggataccttgcctatgctgggcaatgtcctgctgctctgtttcttc
gtctttttcatctttggcatcgttggtgttcagctgtgggcagggctgcttcgaaaccga
tgcttcctccctgagaatttcagcctcccgctgagtgtggacttggagccttactaccag
acagagaatgaggatgagagccccttcatctgctctcagcctcgggagaatggcatgcga
tcctgcaggagcgtgcccacgctgcgtggggaaggcggtggtggtccaccctgcggtctg
gactatgaagcctataacagttccagcaataccacctgtgtcaactggaaccaatactat
accaactgctctgcaggcgagcacaaccccttcaaaggcgccatcaactttgacaacatt
ggctatgcctggatcgccatcttccaggtcatcacactggagggctgggtcgacatcatg
tactttgtgatggatgctcattccttctacaacttcatctacttcattcttctcatcatc
gtgggctccttcttcatgatcaacctgtgcctggtggtgatcgccacgcagttctctgag
accaagcaacgggagagtcagctgatgcgggagcagcgtgtacgattcctgtccaatgct
agcaccctggcaagcttctctgagccaggcagctgctatgaggagcttctcaagtacctg
gtgtacatcctccgcaaagcagcccgcaggctggcccaggtctctagggctgtaggcgtg
cgggctgggttgctcagcagcccggtggcccgtggtgggcaggagccccagcccagtggc
agctgctctcgttcacaccgtcgtctgtctgtccaccacctggtccaccaccatcaccac
caccatcaccactaccacctgggtaatgggacgctcagagttccccgggccagcccagag
atccaggacagggatgccaatgggtcccgctggctcatgctgccaccaccctctaccccc
actccctctgggggccctccgaggggtgcggagtctgtacacagcttctaccatgctgac
tgccacttggagccagtccgttgccaggcgccccctcccaggtccccatcggaggcatct
ggcaggactgtgggtagtgggaaggtataccccactgtgcataccagccctccaccagag
atgctgaaggataaggcactagtggaggtggcccccagccctgggccccccaccctcacc
agcttcaacatcccacctgggcccttcagctccatgcacaagctcctggagacacagagt
acgggagcctgccatagctcctgcaaaatctccagcccttgctccaaggcagacagtgga
gcctgtgggccggacagttgtccctactgtgcccggacaggagcaggggagccagagtcc
gctgaccatgaaatgcctgactcagacagtgaggctgtgtatgagttcacacaggacgct
cagcacagcgacctccgggatccccacagacggcgacggcggagcctgggcccagatgca
gagcctagttctgtgctggccttctggaggctgatctgtgacacattccggaagatcgta
gatagcaaatactttggccggggaatcatgatcgctatcctggtcaataccctcagcatg
ggcatcgagtaccacgagcagcctgaggagctcaccaacgccctggaaatcagcaacatc
gtcttcaccagtctctttgccttggagatgctgctgaagctgctcgtctatggtcccttc
ggctacattaagaatccctacaacatctttgatggcgtcattgtggtcatcagcgtgtgg
gagattgtgggccagcagggaggtggcctgtcggtgctgcggaccttccgcctgatgcgg
gtgctgaagctagttcgcttcctgccggcactgcagcggcagctcgtggtgctcatgaag
accatggacaatgtggccaccttctgcatgctgctcatgctcttcatcttcatcttcagc
atcctgggcatgcacctcttcggttgcaagttcgcatctgaacgggatggggacacgttg
ccagaccggaagaattttgactccctgctctgggccattgtcactgtctttcagattctg
actcaggaagactggaataaagtcctctacaatggcatggcctccacatcatcttgggct
gctctttacttcattgccctcatgacttttggcaactacgtgctctttaacctgcttgtc
gccattctcgtggagggtttccaggcagaggaaatcggcaaacgggaagatacgagtgga
cagttaagctgtattcagctgcctgtcaactcccaggggggagatgccaccaagtctgag
tcagagcctgatttcttttcgcccagtgtggatggtgatggggacaggaagaagcgctta
gccttggtggccttgggagaacacgcagaactacgaaagagccttttgccgcctctcatc
atccacacagctgctacaccgatgtcactgcccaagagctccagcacaggtgtgggggaa
gcactgggctctggctctcgccgcaccagtagcagtggatccgctgagcctggagctgcc
catcatgagatgaaatcaccgccaagtgcccgaagctccccgcacagtccctggagcgca
gcaagcagctggaccagcaggcgctccagccggaacagcctgggccgggcccccagcctg
aagcgtaggagcccaagcggggagcggaggtccctgctgtctggagagggtcaggagagc
caagatgaggaagagagttcggaagaggaccgggctagcccagcaggcagtgatcatcgc
cacaggggttccttggaacgtgaggccaagagttcctttgacctgcctgacaccctgcag
gtgcccgggctgcatcgcacagccagcggtcggagctctgcctctgaacaccaagactgt
aatggcaagtcggcttcagggcgtttggcccgcaccctgcggactgatgaccccccactg
gatggggatgatggcgatgatgagggcaacctgagcaaaggggagcgcttacgagcctgg
gtccgagcccggctccctgcctgttgccgagagcgagattcctggtctgcctatatcttc
cctccccaatcaaggtttcgtctcctgtgtcaccggatcatcacccacaagatgtttgac
catgtggtcctcgtcatcatcttcctcaactgtatcaccatcgccatggagcgccccaaa
attgacccccacagcgctgtggtggcgctgggctggtgctttggggagcaggcctacctg
cgcagcagctggaacgtgctggacggcttgctggtgctcatctccgtcatcgacatcctg
gtatccatggtctctgacagcggcaccaagattctcggcatgctgagggtgctgcggctg
ctgcggaccctacgtccactcagggtcatcagccgggcccaggggctgaagctggtggta
gagactctgatgtcatccctcaaacccattggcaacattgtggtcatctgctgtgccttc
ttcatcatttttggaattcttggggtgcagctcttcaaagggaagttcttcgtgtgtcag
ggtgaggacaccaggaacatcactaacaagtccgactgtgctgaggccagttaccggtgg
gtccggcacaagtacaactttgacaacctgggccaggctctgatgtcactgtttgtgctg
gcctctaaggatggttgggttgacatcatgtatgatggactggatgctgtgggcgtggac
cagcagcccatcatgaaccacaacccttggatgctgctctacttcatctccttcctcctc
atcgtggccttcttcgtcctgaacatgtttgtgggcgtggtggtggagaacttccataag
tgcaggcaacaccaggaggaggaggaggcgcggcggcgggaggagaagcgactaaagagg
ctggagaaaaagagaaggaatctaatgttggacgatgtaattgcttccggcagctcagcc
agcgctgcgtcagaagcccagtgcaagccctactactctgactactcgcgcttccggctc
ctcgtccaccacctgtgtaccagccactacctggacctcttcattactggtgtcatcggg
ctgaatgtggtcacgatggccatggaacattaccagcagccccagatcctggacgaggct
ctgaagatctgcaactacatctttaccgtcatctttgtcttggagtcagtattcaaactt
gtggccttcggcttccgccggttcttccaggacaggtggaaccagctggacctggctatt
gtgcttctgtccatcatgggcatcacactggaagagattgaggtcaatgcttcactgccc
atcaaccccaccatcatccgtatcatgagggtgctccgcattgctcgagttctgaagctg
ttgaagatggctgtgggcatgcgggcactgctggacacggtgatgcaggccctgccccag
gtggggaacctgggacttctcttcatgctattatttttcatctttgcagctctgggcgtg
gagctctttggagacctggagtgtgatgagacacacccttgtgagggcttgggccggcat
gccacctttaggaactttggtatggcctttctgaccctcttccgagtctccactggtgac
aactggaatggtattatgaaggacaccctccgggactgtgaccaggagtccacctgctac
aacaccgtcatctcacccatctacttcgtgtccttcgtgctgacggcccagtttgtgctg
gtcaacgtggtcatagccgtgctgatgaagcacctggaagagagcaacaaagaggccaag
gaggaggcggagctggaggcggagctggagctagagatgaagacactcagcccacagccc
cactccccactgggcagccccttcctctggcctggggtggaaggtgtcaatagccctgac
agccctaagcctggggctccacacaccatggcccacattggagcagcctcttcaggcttc
tcccttgagcaccccacggacagacagctgtttgacaccatctccctgctgatccagggc
tccctggagggggagctgaagctgatggacgagctggcaggcccagggggccagccctct
gccttcccttccgcccccagcccgggcgactccgacccacagatccctctagctgagatg
gaggctctgtctctgacgtcagagattgtgtctgaaccgtcctgctctctagctctgacg
gatgactctttgcctgatgacactcacacactcttacttagtgccctggagagcaatatg
gtacctcacactgaggaggggccagtcccgctaggaccagacctgctgactgtgaggaag
tctggtgtcagccggacacactctctgcccaatgacagctacatgtgccgcaatgggagc
actgccgagagatccctaggacacaggggctgggggctccccaaagcccagtcaggctcc
atcttgtctgttcactcccaaccagcagacaccagctgcatcctacagcttcccaaagat
gcatactatctgctccagcctcatggggctcccacctggggcgccatccctaaactaccc
ccacctggccgctcccctctggctcagaggcctctcaggcgccaggcagcaataaggact
gactccctggacgtgcagggcctgggtagccgggaagacctgttgtcagaggtgagtggg
ccctcctgccctctgacccgctcctcatccttctggggcgggtcgagcatccaggtgcag
cagcgctccggcagccagagcaaagtctccaagcacatccgcctgccagctccttgccca
ggcctggaacccggctgggccaaggaccctcaagagaccagaagcagcttagagctggac
acggagctgagctggatttcaggagacctcctgcccagcagccaggaagaacccctgtcc
ccacgggacttgaagaagtgctacagtgtagaggcccagagctgccggcgcaggcctggg
tcctggctagacgaacagaggagacactccatcgctgtcagctgcctggacagcggctcc
cagccccgcctatgtccaagcccctcaagcctcgggggccaacctcttgggggccctggg
agccggcctaagaaaaaactcagcccacccagtatctctatagaccccccggagagccag
ggccctcggcccccatgcagtcctggcgtctgcctcaggaggagggcgccggccagtgac
tcgaaggatccctcggcctccagcccccttgacagcacggctgcctcaccctccccaaag
aaagatgcgctgagtctctctggtttgtcttctgacccaacagacctggacccctga

KEGG   Mus caroli (Ryukyu mouse): 110309492
Entry
110309492         CDS       T05910                                 

Gene name
Cacna1d
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D isoform X1
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04218  Cellular senescence
mcal04260  Cardiac muscle contraction
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04270  Vascular smooth muscle contraction
mcal04530  Tight junction
mcal04713  Circadian entrainment
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04912  GnRH signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04924  Renin secretion
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05031  Amphetamine addiction
mcal05410  Hypertrophic cardiomyopathy
mcal05412  Arrhythmogenic right ventricular cardiomyopathy
mcal05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110309492 (Cacna1d)
   04020 Calcium signaling pathway
    110309492 (Cacna1d)
   04024 cAMP signaling pathway
    110309492 (Cacna1d)
   04022 cGMP-PKG signaling pathway
    110309492 (Cacna1d)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110309492 (Cacna1d)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110309492 (Cacna1d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110309492 (Cacna1d)
   04929 GnRH secretion
    110309492 (Cacna1d)
   04912 GnRH signaling pathway
    110309492 (Cacna1d)
   04921 Oxytocin signaling pathway
    110309492 (Cacna1d)
   04935 Growth hormone synthesis, secretion and action
    110309492 (Cacna1d)
   04924 Renin secretion
    110309492 (Cacna1d)
   04925 Aldosterone synthesis and secretion
    110309492 (Cacna1d)
   04927 Cortisol synthesis and secretion
    110309492 (Cacna1d)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110309492 (Cacna1d)
   04261 Adrenergic signaling in cardiomyocytes
    110309492 (Cacna1d)
   04270 Vascular smooth muscle contraction
    110309492 (Cacna1d)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110309492 (Cacna1d)
  09156 Nervous system
   04724 Glutamatergic synapse
    110309492 (Cacna1d)
   04727 GABAergic synapse
    110309492 (Cacna1d)
   04725 Cholinergic synapse
    110309492 (Cacna1d)
   04728 Dopaminergic synapse
    110309492 (Cacna1d)
   04726 Serotonergic synapse
    110309492 (Cacna1d)
   04723 Retrograde endocannabinoid signaling
    110309492 (Cacna1d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110309492 (Cacna1d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110309492 (Cacna1d)
   05020 Prion disease
    110309492 (Cacna1d)
   05022 Pathways of neurodegeneration - multiple diseases
    110309492 (Cacna1d)
  09165 Substance dependence
   05031 Amphetamine addiction
    110309492 (Cacna1d)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110309492 (Cacna1d)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110309492 (Cacna1d)
   05414 Dilated cardiomyopathy
    110309492 (Cacna1d)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110309492 (Cacna1d)
   04934 Cushing syndrome
    110309492 (Cacna1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110309492 (Cacna1d)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110309492 (Cacna1d)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Other DBs
NCBI-GeneID: 110309492
NCBI-ProteinID: XP_021037849
Ensembl: MGP_CAROLIEiJ_G0019049
UniProt: A0A6P5R360
LinkDB
Position
14
AA seq 2179 aa
MMMMMMMKKMQHQRQHQEDHANEANYARGTRLPISGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGETQGCCGTLWCWWKRRGAAKTGPSGCRRWGQAISKSKLSRRWRRWNRFNRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELELMSPLGVSVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKVTIDDYQEDAEDKDPYPP
CDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCH
KLINHHVFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTT
FGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFI
LYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGP
VYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDIL
NMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADPSESENIPLP
TATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAML
FFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKL
CDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPH
HLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNS
DGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDE
VTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISC
DLQDDEPEESKPEEEDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSMPPA
SDTEKPLFPPAGNSVCHNHHNHNSIGKQAPTSTNANLNNANMSKAAHGKRPSIGNLEHVS
ENGHYTCKHDRELQRRSSIKRTRYYETYIRSESGDEQFPTICREDPEIHGYFRDPRCLGE
QEYFSSEECCEDDSSPTWSRQNYSYYNRYPGSSMDFERPRGYHHPQGFLEDDDSPTGYDS
RRSPRRRLLPPTPPSHRRSSFNFECLRRQSSQDDVLPSPALPHRAALPLHLMQQQIMAVA
GLDSSKAQKYSPSHSTRSWATPPATPPYRDWSPCYTPLIQVDRSESMDQVNGSLPSLHRS
SWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVS
ATKHEIADACDLTIDEMESAASTLLNGSVCPRANGDMGPISHRQDYELQDFGPGYSDEEP
DPGREEEDLADEMICITTL
NT seq 6540 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcaacatcaacggcagcaccaagaggaccat
gcgaacgaggcaaactatgcaagaggcaccagactccctatttctggtgaaggaccaact
tctcagcccaacagctccaagcaaactgtcctatcttggcaagctgcaattgatgctgct
agacaggccaaggccgcccagaccatgagcacctctgcacccccacctgtaggatctctc
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtctaacagc
cgacctgcccgtgcccttttctgtttatccctcaataaccccatccgaagagcctgcatt
agtatagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccattccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtggagacatttctgaagatt
atagcgtatggactgttgctgcatcctaatgcttacgttaggaatggatggaatttactg
gattttgttatagtaatagtaggattgtttagtgtaattctggaacaattaaccaaagaa
acagaaggcgggaaccactctagtggcaaatcaggaggctttgatgtcaaagccctccgt
gccttccgagtgttaagaccacttcgacttgtatcaggagtgcccagtttacaagttgtt
ctgaactccattataaaagccatggtccccctccttcacatagcccttttggtattattt
gtaattatcatctatgctattataggattggaactttttattggaaaaatgcacaaaaca
tgtttttttgctgactcagatatagtagctgaagaggacccagctccatgtgcgttctca
gggaatggacgccagtgcaccgccaatggcacggaatgtaggagtggctgggttggcccc
aatggaggcatcactaactttgataactttgcctttgccatgctcactgtgttccagtgc
attaccatggaaggctggacagatgtgctctactgggttaatgatgcgataggatgggaa
tggccatgggtgtattttgttagtctgatcatccttggctcatttttcgtccttaacctg
gttcttggtgtccttagtggagaattctccaaggaaagagagaaggctaaagcacgtgga
gatttccagaagcttcgggagaaacagcagctggaagaggacctcaagggctacctggac
tggatcacccaggcagaagacattgatcccgagaacgaggaggagggtggcgaggaaggc
aaacgaaacactagcatgcccaccagcgagactgaatctgtcaacacagagaacgtaagt
ggtgaaggcgagacccagggatgctgtggaactctctggtgctggtggaaaagaagaggc
gcggccaagaccgggccctctgggtgtcggcggtggggtcaggccatctcgaaatccaaa
ctcagccgtcgctggcgtcgctggaaccggttcaatcgcaggaggtgcagggctgccgtg
aagtctgtcacgttttactggctggtgattgtcctggtgtttctcaacactttaactatt
tcctctgagcattacaatcagccagactggctgacacagattcaagacatcgcaaacaaa
gtcctcttggctctgttcacctgtgagatgctggtgaagatgtacagcctgggcctccag
gcttactttgtctccctcttcaaccgctttgattgctttgtggtgtgtgggggcatcacc
gaaaccatcctggtggaactggagctcatgtctcccctgggggtctctgtgttccggtgt
gtgcgcctcctgagaatcttcaaagtgaccaggcactggacctccctgagcaacttggtg
gcatccttgttaaactccatgaagtccatcgcctctctgctgttgctcctcttcctcttc
atcatcatcttctccttgctggggatgcagttgtttggtgggaagtttaattttgacgag
actcaaaccaagcgaagcacctttgacaactttccgcaagcactcctgacggtgttccag
atcctgacaggcgaagactggaatgcggtgatgtatgacggcatcatggcctatggaggc
ccttcctcttctgggatgattgtctgtatctacttcatcatccttttcatctgtggtaac
tatatcctgctgaatgtcttcttggccatcgctgtggacaatttggctgatgctgaaagt
ctgaacactgctcagaaagaggaagctgaagaaaaagaaaggaaaaaaattgccagaaaa
gaaagcctagaaaacaaaaagaacaacaaaccagaagtcaaccagatagccaacagtgac
aacaaggttacaattgatgattatcaggaagatgctgaagataaggacccttacccgccc
tgtgatgtgccagtaggtgaagaggaagaggaggaggaagaggatgagcccgaagttcct
gctggtccccgccctcgcagaatctcagagttgaacatgaaggagaagattgcgcccatc
ccagaaggaagcgccttcttcattcttagcaagaccaacccgatccgtgtgggttgccac
aagctcattaaccaccacgtcttcaccaacctcatcctggtcttcatcatgctgagcagc
gccgccctggctgcagaggaccccatccgtagccactcattccgcaacacgatactgggc
tactttgactatgccttcacagccatctttacggttgaaatcctgttaaagatgacaact
tttggagccttcttgcacaaaggggctttctgcaggaactacttcaatttgctggacatg
ctggttgttggggtgtcgctggtgtcctttgggattcagtccagcgccatctccgttgtg
aagattctgagggttttgagggtcttgcggcctctcagagcaatcaacagagcaaaggga
cttaagcacgtggtccagtgtgtctttgtggccatccgaaccattggcaacatcatgatc
gtcacgaccctgctccagttcatgtttgcatgcattggggtccagctgttcaaggggaag
ttctaccgttgcacagatgaagccaaaagtaaccctgaggagtgcaggggacttttcatt
ctttataaggacggcgatgttgacagtcctgtggtccgtgagaggatctggcaaaatagt
gatttcaattttgacaatgtcctttcggctatgatggcgctgttcacagtctcaactttt
gagggctggcccgcgttgctatacaaagctattgattcaaacggtgagaatgttggtcct
gtctacaactaccgtgtggagatctccatcttcttcatcatctacatcatcatcgttgcc
ttcttcatgatgaacatctttgtgggcttcgtcatcgtcaccttccaggaacagggagaa
aaagagtataagaactgtgagctggacaaaaatcagcgtcagtgtgttgaatatgccttg
aaagcacgccccttaaggagatacatccccaaaaacccataccagtacaagttctggtac
gtggtgaactcctcaccgttcgaatacatgatgtttgtcctcatcatgctcaacacactc
tgcctggccatgcagcactatgagcagtccaagatgttcaatgatgctatggacattctg
aacatggtcttcacaggggtcttcactgttgagatggttttgaaagtcattgctttcaag
cccaaggggtattttagtgacgcctggaacacgtttgactccctcatcgtaatcggcagc
attatagacgtggccctcagcgaagccgacccatctgaaagtgagaatatccctctccca
actgccacacctgggaactctgaagagagcaatagaatctccatcacctttttccgtctt
ttccgagtgatgcggttggtgaaacttctcagcaggggggaaggcatccggacactgctg
tggaccttcatcaagtcctttcaggcgctgccgtatgtcgccctcctcatcgccatgctc
ttcttcatctacgctgtcataggcatgcagatgtttgggaaagttgccatgagagacaac
aaccagatcaatagaaacaacaacttccagaccttccctcaggcagtgctcctactcttc
aggtgtgcgacaggggaagcctggcaggagatcatgcttgcctgcctcccgggaaagctg
tgcgacccagactccgattacaacccaggagaggagtacacttgtgggagcaactttgcc
attgtctacttcatcagcttttacatgctctgtgcattcctgatcatcaacctctttgtg
gctgtcatcatggacaattttgactacctgactcgggactggtctattctggggcctcac
cacttggacgaattcaaaagaatatggtcagaatatgaccctgaagcaaagggaaggata
aaacaccttgatgtggtcactctgctccggcggatccagcctcccctggggtttggaaag
ttatgcccacaccgagtagcgtgtaagagattggttgccatgaacatgcctctcaacagt
gatgggacagtcatgttcaatgcaaccctgtttgctttggtccggacagctctcaagatc
aagactgaagggaacctggagcaagctaatgaagaactccgggctgtgatcaagaaaatc
tggaagaaaacaagcatgaagctgcttgaccaagttgtccctccagctggtgatgatgag
gtaaccgtggggaagttctatgccactttcctgatacaggactactttaggaaattcaag
aaacggaaagagcaaggactggtggggaagtaccctgcgaagaacaccacaattgcccta
caggcgggattaaggaccctgcatgacattgggccagaaatcagacgggctatatcctgt
gacttgcaagatgacgagccagaagaatccaaaccagaagaagaagatgtattcaaaaga
aatggtgccctgcttggaaaccatgtcaatcatgttaatagtgataggagagattccctt
cagcagaccaataccacccaccgtcccctgcatgtccaaaggccttcaatgccacctgca
agtgatactgagaaaccgctgtttcctccagcaggaaattcggtgtgtcataaccatcat
aaccataattccatagggaagcaagctcccacctcaacaaatgccaatctcaataatgcc
aatatgtccaaagctgcccacggaaagcggcccagcattgggaatcttgagcatgtgtct
gaaaatgggcattacacctgcaagcacgatcgagagcttcaaagaaggtccagtattaaa
agaacccgctattacgagacttacattaggtccgagtcaggagatgagcaatttccaacc
atttgccgtgaagaccctgagatacacggctacttccgagacccccgctgcttgggggaa
caggagtatttcagtagcgaggagtgctgtgaggatgacagctctcccacctggagcagg
caaaactacagctactacaacaggtacccaggcagctccatggactttgagaggccccga
ggctaccaccacccccaaggcttcttagaagatgatgactctcccactggctatgattca
cggagatctccgaggagacgccttctacctcctaccccaccatcccatcggaggtcctcc
ttcaactttgagtgtctacgcaggcaaagcagccaagatgacgtccttccatcgcctgcc
ctgcctcaccgcgctgccctgcccctgcacctgatgcagcagcagatcatggctgttgca
ggcctagattccagtaaagcccagaagtactcaccgagccactctacccggtcgtgggcc
acccctccagcaacccctccataccgagactggagcccatgctacacccctttgatccag
gtggaccgctcagaatctatggaccaggtcaatggcagcctgccatccctacaccgcagt
tcctggtacacagatgaacccgacatctcctataggactttcacgccagccagtctgact
gtccccagcagcttccggaacaaaaacagcgacaagcagaggagtgcagacagcctggtg
gaggcagtcctgatatccgaaggcttgggacgctacgcgagggaccccaaatttgtctca
gcgacaaaacatgagattgccgatgcctgtgacctaaccatagacgagatggaaagtgca
gccagcaccctgctcaatggcagtgtgtgtcctcgagccaacggggacatgggccccatc
tcccaccgccaggactatgagctccaggactttggtcctggctacagtgacgaggagcca
gaccctgggcgagaggaagaggacctggcagatgagatgatttgcattaccaccttgtag

DBGET integrated database retrieval system