KEGG   Mus caroli (Ryukyu mouse): 110289380
Entry
110289380         CDS       T05910                                 

Gene name
Bcl2l11
Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04068  FoxO signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04932  Non-alcoholic fatty liver disease
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110289380 (Bcl2l11)
   04151 PI3K-Akt signaling pathway
    110289380 (Bcl2l11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110289380 (Bcl2l11)
   04215 Apoptosis - multiple species
    110289380 (Bcl2l11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289380 (Bcl2l11)
   05206 MicroRNAs in cancer
    110289380 (Bcl2l11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110289380 (Bcl2l11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110289380 (Bcl2l11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110289380 (Bcl2l11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110289380 (Bcl2l11)
SSDB
Motif
Pfam: Bim_N Bclx_interact BMF
Other DBs
NCBI-GeneID: 110289380
NCBI-ProteinID: XP_021011215
Ensembl: MGP_CAROLIEiJ_G0024269
UniProt: A0A6P5PE52
LinkDB
Position
2
AA seq 196 aa
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPDGEGDRCPHGSPQGPL
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYQEAEGHPQMV
ILQLLRFIFRLVWRRH
NT seq 591 nt   +upstreamnt  +downstreamnt
atggccaagcaaccttctgatgtaagttctgagtgtgacagagaaggcggacaattgcag
cccgctgagaggcctccccagctcaggcctggggcccctacctccctacagacagaacag
caaggtaatcccgacggcgaaggggaccgctgcccccacggcagccctcagggcccgctg
gccccaccggccagccctggcccttttgctaccagatccccacttttcatctttgtgaga
agatcttctctgctgtcccggtcctccagtgggtatttctcttttgacacagacaggagc
ccggcacccatgagttgtgacaagtcaacacaaaccccaagtcctccttgccaggccttc
aaccactatctcagtgcaatggcttccataaggcagtctcaggaggaacctgaagatctg
cgcccggagatacggattgcacaggagctgcggcggatcggagatgagtttaacgaaact
tacacaaggagggtgtttgcaaacgattaccaagaggctgaaggccaccctcaaatggtt
atcttacaactgttacgcttcatcttccggctggtatggagaaggcactga

DBGET integrated database retrieval system