KEGG   Mus caroli (Ryukyu mouse): 110289488
Entry
110289488         CDS       T05910                                 

Gene name
Bmp2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110289488 (Bmp2)
   04390 Hippo signaling pathway
    110289488 (Bmp2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110289488 (Bmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289488 (Bmp2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110289488 (Bmp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110289488 (Bmp2)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110289488 (Bmp2)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110289488 (Bmp2)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110289488 (Bmp2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110289488
NCBI-ProteinID: XP_021011367
Ensembl: MGP_CAROLIEiJ_G0024349
UniProt: A0A6P5P8Y1
LinkDB
Position
2
AA seq 394 aa
MVAGTRCLLVLLLPQVLLGGAAGLIPELGRKKFAAASGRPLSRPSDDVLSEFELRLLSMF
GLKQRPTPSKDVVVPPYMLDLYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEEAVEEL
PEMSGKTARRFFFNLSSVPTDEFLTSAELQIFREQIQEALGNSSFQHRINIYEIIKPAAA
NLKFPVTRLLDTRLVNQNTSQWESFDVTPAVMRWTAQGHTNHGFVVEVAHLEENPGVSKR
HVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLY
VDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCV
PTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagtgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcattccagagctgggccgcaagaagtttgccgccgcatccggccgaccc
ttgtcccggccttcggacgacgtcctcagcgagtttgagttgaggctgctcagcatgttt
ggcctgaagcagagacccacccccagcaaggacgtcgtggtgcccccctatatgctagac
ttgtaccgcaggcactcgggccagccaggagcgcccgccccagaccaccggctggagagg
gcagccagccgcgccaacaccgtgcgcagcttccatcacgaagaagccgtggaagaactt
ccagagatgagtgggaaaacggcccgacgcttcttcttcaatttaagttctgtccccact
gacgagtttctcacatctgcagaactccagattttccgggaacagatacaggaagctttg
ggaaacagtagtttccagcaccgaattaatatttatgaaattataaagcctgcagcagcc
aacttgaaatttcctgtgaccagactattggacaccaggttagtgaaccagaacacgagt
cagtgggagagcttcgacgtcaccccagctgtgatgcggtggaccgcacagggacacacc
aaccatggctttgtggtggaagtggcccatttagaggagaacccaggtgtctccaagaga
catgtgaggatcagcaggtctttacaccaagatgaacacagctggtcacagataaggcca
ttgctagtgacttttggacatgatggaaaaggacatccgctccacaaacgagaaaagcgt
caagccaaacacaaacagcggaagcgcctcaagtccagctgcaagagacaccctttgtat
gtggacttcagtgatgtggggtggaatgactggatcgtggcacctccgggctatcatgcc
ttttactgtcatggggagtgtccttttcccctggctgaccacctgaactccactaaccat
gccatagtgcagactctggtgaactctgtgaattccaaaatccctaaggcatgctgtgtc
cccacagagctcagcgcaatctccatgttgtacctagatgaaaatgaaaaggttgtgcta
aaaaattatcaggacatggttgtggagggttgtgggtgtcgttag

KEGG   Mus caroli (Ryukyu mouse): 110309274
Entry
110309274         CDS       T05910                                 

Gene name
Bmp4
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04919  Thyroid hormone signaling pathway
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110309274 (Bmp4)
   04390 Hippo signaling pathway
    110309274 (Bmp4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110309274 (Bmp4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110309274 (Bmp4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110309274 (Bmp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110309274 (Bmp4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110309274 (Bmp4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110309274 (Bmp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110309274 (Bmp4)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110309274 (Bmp4)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110309274 (Bmp4)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Morphogens
   110309274 (Bmp4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110309274
NCBI-ProteinID: XP_021037499
Ensembl: MGP_CAROLIEiJ_G0019156
UniProt: A0A6P7PWI2
LinkDB
Position
14
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAIIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRS
FHHEEHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHTLTRRRAKRSPKHHPQR
SRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagaccgggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctacagatgtttgggttgcgccgccgtccgcagcctagcaagagcgccatcattccg
gattacatgagggatctttaccggctccagtctggggaggaggaggaggaagagcagagc
cagggaaccgggcttgagtacccggagcgtcccgccagccgagccaacactgtgaggagt
ttccatcacgaagaacatctggagaacatcccagggaccagtgagagctctgcttttcgt
ttcctcttcaacctcagcagcatcccagagaatgaggtgatctcctcggcagagctccgg
ctctttcgggagcaggtggaccagggccctgactgggaacagggcttccaccgtataaac
atttatgaggttatgaagcccccagcagaaatggttcccggacacctcatcacacgacta
ctggacaccagactagtccatcacaatgtgacacggtgggaaactttcgatgtgagccct
gcagtccttcgctggacccgggaaaagcaacccaattatgggctggccattgaggtgact
cacctccaccagacacggacccaccagggccagcacgtcagaatcagccgatcgttacct
caagggagtggagattgggcccaactccggcccctcctggtcacttttggccatgatggc
cgaggccataccttgacccgcaggagggccaaacgtagtcccaagcatcacccacagcgg
tccaggaagaagaataagaactgccgtcgccattcactctacgtggacttcagtgacgtg
ggctggaatgattggattgtggccccacccggctaccaggccttctactgccacggggac
tgtccctttccactggctgatcacctcaactcaaccaaccatgccattgtgcagacccta
gtcaactctgttaattctagcatccctaaggcctgttgcgtccccactgaactgagtgcc
atttccatgttgtacctggatgagtacgacaaggtggtgttgaaaaattatcaggaaatg
gtggtagaagggtgtggatgccgctga

DBGET integrated database retrieval system