KEGG   Mus caroli (Ryukyu mouse): 110289525Help
Entry
110289525         CDS       T05910                                 

Gene name
Abl1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04110  Cell cycle
mcal04360  Axon guidance
mcal04722  Neurotrophin signaling pathway
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05220  Chronic myeloid leukemia
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110289525 (Abl1)
   04012 ErbB signaling pathway
    110289525 (Abl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110289525 (Abl1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110289525 (Abl1)
  09158 Development and regeneration
   04360 Axon guidance
    110289525 (Abl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289525 (Abl1)
   05206 MicroRNAs in cancer
    110289525 (Abl1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110289525 (Abl1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110289525 (Abl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110289525 (Abl1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110289525 (Abl1)
Protein kinases [BR:mcal01001]
 Non-receptor tyrosine kinases
  ABL family
   110289525 (Abl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110289525
NCBI-ProteinID: XP_021011424
Ensembl: MGP_CAROLIEiJ_G0023416
LinkDB All DBs
Position
2
AA seq 1142 aa AA seqDB search
MGQQPGKVLGDQRRPSLPALHFIKGAGKRDSSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGAAGS
MLQAPELPTKTRTCRRAAEQKDAPDTPELLHTKGLGESDALDSEPAISPLLPRKERGPPD
GSLNEDERLLPKDKKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQPERRGASEDDSREL
CNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAE
EESGMSSSKRFLRSCSASCMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPAL
PRKRTSESRSEQVAKSTAMPPPRLVKKTEEAAEEGFKDMESSPGSSPPSLTPKLLRRQVT
ASPSSGLSHKEEATKGSASGTGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGR
DKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEAGGATKTKCTSLAVDAVNTDPTKAG
PPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTALAPSPLAGDQQPSSAAFIPLIST
RVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCV
SYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIV
RR
NT seq 3429 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaagaaggcctagtttgcccgccctg
cattttatcaaaggggcagggaagagggactcatcgaggcatgggggcccacactgcaat
gtctttgtggaacacgaagctctgcagaggccagtggcgtctgactttgagccccagggt
ctcagcgaagcagctcgatggaactccaaggaaaaccttcttgctgggcccagtgaaaat
gaccccaacctttttgtggcactctatgattttgtggccagtggagataacactctcagc
atcactaaaggtgaaaagctccgggtcttgggttataatcacaacggggaatggtgtgaa
gcccaaacaaaaaatggccaaggatgggtcccaagcaactacatcacccccgtcaacagc
ctggagaaacattcctggtatcatggccctgtatctcgaaatgctgctgagtatctgctg
agcagcggaatcaacggcagcttcttagtgcgggagagtgagagtagccctggccagaga
tccatctcgctgcggtatgaagggagggtgtaccactacaggatcaacactgcctctgat
ggcaagctgtacgtctcctcggagagccgcttcaacactctggctgagttagttcaccat
cactccacggtggctgatggcctcatcaccacactccactacccagctcccaagcgcaac
aagcccaccatctacggtgtgtcccccaactacgacaagtgggaaatggagcgcactgac
atcaccatgaagcacaagttgggtggaggccagtacggggaggtgtacgagggcgtttgg
aagaagtacagcctcactgtggccgtgaagaccttgaaggaggacaccatggaggtggag
gaattcctgaaggaagccgcggtgatgaaggagatcaaacaccctaacctggtgcagctg
ctaggggtgtgtacccgggaaccaccgttctacataatcactgagtttatgacctatggg
aacctgctggactacctgcgggagtgtaaccggcaggaggtgagcgccgtggtgctgctt
tacatggccacacagatctcatcagccatggagtacttggagaagaagaacttcatccac
agagaccttgctgcccggaactgcctggtaggggaaaaccacttggtgaaggtggctgat
tttggcctgagcaggttgatgacaggggacacctacacggcccatgctggagccaaattc
cccatcaagtggaccgcgcctgagagcctggcttacaacaagttctccatcaagtcggac
gtgtgggcatttggagtactgctctgggagattgctacctatggcatgtcaccttacccg
ggaattgacctgtctcaggtttatgagctgctggaaaaagactaccgaatggagcgccct
gaaggctgcccggagaaggtctacgagctcatgcgagcatgttggcagtggaacccctcc
gaccggccctcctttgctgaaatccaccaagcctttgaaaccatgttccaggaatccagt
atctcagatgaggtggagaaggagctggggaaacgaggcacgagaggagctgctgggagt
atgctgcaggccccagagctgcccaccaagaccagaacctgcaggagagcagctgagcag
aaagatgcgcctgacacccctgagctgctccacacgaagggcctgggagaaagcgatgca
ctggacagtgagcctgctatatcgccactgcttcctcggaaagagcgtgggcccccagat
ggcagcctaaatgaagacgagcgccttctccccaaagacaaaaagaccaacctgttcagc
gctttgatcaagaagaagaagaaaatggcgccgacaccccctaagcgcagcagttccttc
cgagagatggatggccagccagaacgcagaggggctagtgaggatgacagcagggaactc
tgcaatggaccaccagctctcacctcagatgcagcagagcctaccaagtccccaaaggcc
agtaatggggctggcgtccctaatggagccttccgggagccgggcaactcaggcttccgt
tctccccacatgtggaaaaagtccagcacactgaccgggagccgcctggctgctgccgaa
gaggagagcggcatgagctccagtaagcgcttcctgcgttcttgctcagcctcctgcatg
ccccatggggcaagagacacagagtggcggtcggttacactgcctcgagacctgccgtct
gctggcaagcagtttgactcatccacttttggagggcacaaaagtgaaaagccagctctg
cctcggaaacggaccagtgagagcaggtccgagcaggtggccaaaagcacagcgatgccc
cctccccggctggtgaagaagaccgaggaggccgctgaagaaggcttcaaagacatggaa
tccagccctggctccagccctcccagcttgactcccaaactcctccgcaggcaggtcact
gcctctccttcctctggcctctctcacaaggaagaggccaccaagggcagtgcctcaggc
acggggactccagccactgcagagccagcaccccccagcaacaaagtgggcctcagcaag
gcctcctctgaggagatgcgcgtaaggaggcacaagcacagctcggagtccccaggaaga
gacaaggggcgactggctaagctcaagcctgccccgccgcctcctcctgcctgcacagga
aaagcaggcaagcccgcacagagccccagccaagaggccggggaggcagggggagccaca
aagacaaaatgcacgagtctggctgtggatgctgtgaacactgaccccaccaaggccggt
ccacctggagaaggactgagaaagcctgtgcccccatctgtgccaaagccccagtcgact
gctaagcctccagggacccccaccagcccggtctccaccccctccacagcactagctcct
tcacccctggctggggaccagcagccatcatctgctgccttcatccccctcatatcaacc
cgtgtgtctcttaggaagacccgccagccgccagagcgcattgccagtggcaccattacc
aagggtgtggttctggacagtactgaggccctgtgccttgccatctcccggaactcagag
cagatggccagccacagtgctgtactggaggctggcaagaacctgtacactttctgtgtg
agctatgtggactctatccagcagatgaggaacaaatttgccttccgtgaggctatcaac
aagctagagagcaacctccgagagctgcagatctgccctgccacagcctccagtgggcca
gctgccacccaagacttcagcaagctgcttagctctgtgaaggagatcagcgacattgtc
cggaggtag

DBGET integrated database retrieval system