KEGG   Mus caroli (Ryukyu mouse): 110289544
Entry
110289544         CDS       T05910                                 

Definition
(RefSeq) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial isoform X1
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00100  Steroid biosynthesis
mcal01100  Metabolic pathways
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110289544
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110289544
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110289544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mcal00199]
    110289544
Enzymes [BR:mcal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     110289544
Cytochrome P450 [BR:mcal00199]
 Cytochrome P450, animal type
  CYP24 family
   110289544
SSDB
Motif
Pfam: p450 Diphthami_syn_2
Other DBs
NCBI-GeneID: 110289544
NCBI-ProteinID: XP_021011464
Ensembl: MGP_CAROLIEiJ_G0024728
UniProt: A0A6P5P571
LinkDB
Position
2
AA seq 514 aa
MSCPIDKRRPLIAFLRRLRDLGQPPRSVTSKAHVSRAPKEVPLCPLMTDGETRNVTSLPG
PTNWPLLGSLLEIFWKGGLKKQHDTLAEYHKKYGQIFRMKLGSFDSVHLGSPSLLEALYR
KESAHPQRLEIKPWKAYRDHRNEAYGLMILEGREWQRVRSAFQKKLMKPVEIMKLDKKIN
EVLADFMGQIDELRDERGRIQDLYSELNKWSFESICLVLYEKRFGLLQKDTEEEALTFIA
AIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLAWDTIFKSVKPCIDHRLERYSRQPGAD
FLCDIYQQDHLSKKELYAVVTELQLAAVETTANSLMWILYNLSRNPQVQQRLLQEIQSVL
PDNQMPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGDYTLPTGTVLTLNTQ
VLGSSEDNFEDADKFRPERWLEKEKKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWII
QKYNIVATDNEPVEMLHLGILVPSRELPIAFCPR
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgagctgccccattgacaaaaggcgccccctgatcgctttcctgcgccggctgcgggac
ctcgggcaacccccaaggtccgtgacatccaaggcgcacgtttcgcgtgcgccaaaagag
gtgcccctctgcccgctgatgaccgacggtgagactcggaacgtcacctccttgcctgga
cccaccaactggccactgctgggcagcctactggagattttttggaaaggtggcctgaag
aaacagcacgacacactggcagagtaccacaagaagtatggccagattttccggatgaag
ctgggctccttcgactcggtgcatctgggctcgccgagcctgctggaagctctgtaccgc
aaagagagcgcgcatccccagcggctggagattaaaccctggaaagcctatcgcgaccac
cgcaacgaagcctacgggctgatgatcctggaaggacgggagtggcagcgggtccgcagc
gccttccaaaagaaactcatgaagcccgtggagatcatgaagctggacaagaaaatcaat
gaggtcttggctgattttatggggcaaatcgatgagctgcgtgatgagagaggccgcatc
caagacttgtacagcgagctgaacaaatggtcctttgaaagcatctgccttgtgttatat
gagaagagattcgggctccttcaaaaggacacagaagaagaagccctgaccttcattgcg
gccatcaaaacaatgatgagcacatttgggaagatgatggtgacccccgtggagctgcac
aagcgcctcaacaccaaagtgtggcaagcgcacacgctggcctgggacaccattttcaaa
tcagtcaagccctgcatcgaccaccgcctagagagatattcccggcagcctggtgcagat
ttcctttgtgatatttatcagcaagatcatctttccaagaaagaactgtatgctgttgtc
acggagctccagctggctgcggtggagacgaccgcaaacagcttgatgtggattctctac
aatctatcccggaatccccaagtgcaacagagacttctccaggaaatccagagcgtgctg
cctgacaaccagatgccacgggcggaagatgtgaggaatatgccctatttaaaggcctgt
ctaaaagagtccatgaggcttaccccaagtgtgccattcacaactcggacccttgacaag
cccaccgttctgggtgactacacgctacccacaggaacagtgttaacactaaatacccag
gtgctgggctctagcgaagacaattttgaagatgctgacaagtttagacccgaacgttgg
cttgaaaaggagaaaaagatcaatcccttcgctcatctcccatttggcgtcgggaagagg
atgtgcatcgggcgccggctggctgagctacagctccacttggctctttgctggataatc
caaaaatataacattgtggctacagacaatgaacctgtggagatgctgcatcttggcatc
ctggtacctagccgggagctgcccattgcgttctgtccacggtag

DBGET integrated database retrieval system