KEGG   Mus caroli (Ryukyu mouse): 110289694
Entry
110289694         CDS       T05910                                 

Gene name
Spint1
Definition
(RefSeq) kunitz-type protease inhibitor 1 isoform X1
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110289694 (Spint1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110289694 (Spint1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110289694 (Spint1)
Peptidases and inhibitors [BR:mcal01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   110289694 (Spint1)
SSDB
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a Chordopox_A13L
Other DBs
NCBI-GeneID: 110289694
NCBI-ProteinID: XP_021011693
Ensembl: MGP_CAROLIEiJ_G0024139
LinkDB
Position
2
AA seq 507 aa
MAGRRLARASISAVGVWLLCALGLQATETELPSAPAELPGGAACLSRFTSGVPSFVLDTE
ASVSNGATFLGSPTARRGWDCVRSCCTTQNCNLALVELQPDGGEDAISACFLMNCLYEQN
FVCKFAPKEGFINYLTQELYRSYRELRTRGFGGSRIPRIWMGIDLKVQLQKPLVLKEADN
TDWHLLQGDSDVRVERKRPEEVELWGLKEGTYLFQLTRTDSDQPEETANLTITVLTAKQT
EDYCLASYKVGRCRGSFPRWYYDPKEQICKSFTFGGCLGNKNNYLREEECMLACKDVQGG
SLHLPPPVCSGSCHATQFRCSNGCCIDGFLECDDTPDCPDGSDEATCEKYTSGFDELQNI
HFLSDRGYCAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEEEQQCLESCR
GISKKDVFGLRREGSIPTVGSAEVAIAVLLVICIIVVLTILGYCFFKNQRKEFHRPLHHP
PPTPASSTVSTTEDTEHLVYNHTTQPL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcgggccgccgcctggcgcgggccagcatctctgcggtcggagtatggctcctttgc
gcgcttggcctccaggccaccgagactgagctgccgtccgcacccgctgagcttcccggg
ggagccgcctgcttgagccgctttaccagcggggtgccgtcctttgtgctggacaccgaa
gcctccgtcagcaacggggccaccttcctgggttccccgacggcgcgccgcggctgggac
tgcgtgcgctcctgctgcaccactcagaactgcaacctggcgctggtggagctgcagcca
gacggcggcgaggacgccatctctgcctgcttcctcatgaactgcctgtacgagcagaac
ttcgtgtgcaagttcgctccgaaggagggcttcatcaactatcttacccaggagctttac
cgctcctaccgcgagctgcggactcgaggctttggaggttcccggatccctcgaatctgg
atgggcatagacttgaaggtccagctgcagaagcccctggtactgaaagaggcagataac
acagactggcacctactgcaaggtgacagtgatgtcagagtagagagaaaacgtccagaa
gaagtggagctgtggggacttaaggagggaacctacctgttccaactgacaagaactgac
tcagaccaaccagaggaaacagccaacctgactatcactgtgctaactgccaagcagaca
gaagattattgcctcgcatcctacaaggtgggccgctgccggggctccttcccacgctgg
tactacgaccccaaggaacagatctgcaaaagtttcacttttggaggttgcctgggcaac
aagaacaactaccttcgtgaggaagagtgcatgctagcctgcaaggatgtacaaggtggg
tctcttcacctcccccctccagtgtgctccggcagctgccatgccacccagttccgctgt
agcaatggctgctgtatcgatggcttcctggagtgtgatgacacgccagactgccctgat
ggctccgacgaggccacctgtgaaaaatacaccagcggctttgatgagcttcagaatatc
catttcctcagtgacagagggtactgtgcagagctgccagacactgggttttgcaaggag
aacatcccacgctggtattacaacccattcagtgaacgctgtgcccgcttcacctatggt
ggttgctatgggaacaagaacaactttgaggaggaacagcagtgtcttgagtcctgccgt
ggcatctccaagaaggatgtgtttggtcttcggagggaaggctccattcccactgtaggc
tctgcggaggtagctattgctgtacttctggtcatctgcatcatagtggtcttaaccatc
ctgggctactgtttcttcaagaaccaaagaaaggaattccacagacccctgcaccaccca
cctcccacaccagccagctccactgtttccaccacagaggacacagagcacctggtttac
aatcacacaacccagcctctctga

DBGET integrated database retrieval system