KEGG   Mus caroli (Ryukyu mouse): 110289726
Entry
110289726         CDS       T05910                                 

Gene name
Shc4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04510  Focal adhesion
mcal04650  Natural killer cell mediated cytotoxicity
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05034  Alcoholism
mcal05100  Bacterial invasion of epithelial cells
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05220  Chronic myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110289726 (Shc4)
   04014 Ras signaling pathway
    110289726 (Shc4)
   04072 Phospholipase D signaling pathway
    110289726 (Shc4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110289726 (Shc4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110289726 (Shc4)
   04062 Chemokine signaling pathway
    110289726 (Shc4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110289726 (Shc4)
   04915 Estrogen signaling pathway
    110289726 (Shc4)
   04917 Prolactin signaling pathway
    110289726 (Shc4)
   04926 Relaxin signaling pathway
    110289726 (Shc4)
   04935 Growth hormone synthesis, secretion and action
    110289726 (Shc4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110289726 (Shc4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110289726 (Shc4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110289726 (Shc4)
   05226 Gastric cancer
    110289726 (Shc4)
   05214 Glioma
    110289726 (Shc4)
   05220 Chronic myeloid leukemia
    110289726 (Shc4)
   05224 Breast cancer
    110289726 (Shc4)
  09165 Substance dependence
   05034 Alcoholism
    110289726 (Shc4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110289726 (Shc4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110289726 (Shc4)
   01522 Endocrine resistance
    110289726 (Shc4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 110289726
NCBI-ProteinID: XP_021011742
Ensembl: MGP_CAROLIEiJ_G0024229
UniProt: A0A6P5PBE6
LinkDB
Position
2
AA seq 626 aa
MRERSQDSQAGLTLYVGLFGHLGMLHRTKYSRFRNESITSLDEGSPGGSVGNKGSSPPPY
PALAPHLPTEDATVSSQESPTALCTLIPRMASMKLANPITFLGLKTFCLGTKQVSRLKLQ
ENQDQTPSRPVSPETNLNRTGPVPAPDPDQVGRRPTSLRPDTCPLPGPGEPSPRSKQDGP
PLQHLLGNGLNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGAHGAIKKRK
APVKFLTTVLGKSNLQFSGMNIKLTVSTSSLTLMNLDNQQIIANHQMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTWEREEVL
VDGVPEDRDHDYYNSIPGKQPPEGGISDVRIQAQATDQMAYCPIRCEKLCYLPGNSTCSG
VYKNCMGRSRPIGIPHERVGQGDAPSLRHFWRVDLFDDPCYVNTQALQSMHSYAGNQSSA
LPQGSPWHLGKAPETVQPGATAKPGSTLALPHIRQQLWDEECFHGKLSRGAAEKLLVKDG
DFLVRESVTSPGQFVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIKYHMDNNLPI
ISSGSEVRLKQPIRKYDNTGLLPPKK
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgcgagaacgcagccaggacagccaggcaggactcacgctgtatgtaggactctttggg
cacctggggatgcttcacaggaccaagtacagccgctttcggaacgagtccatcacgtct
ttggacgaagggagccccggaggctccgttggaaacaagggctcgtcgccgcctccctac
ccagccctggcccctcacctgccgactgaggatgccactgtgtccagccaggaaagcccc
acggcgctgtgcaccttgattccccgtatggcaagcatgaagctggccaaccccattact
tttctgggtctgaaaaccttctgcttgggtacgaaacaggtgagccggttgaagctccaa
gagaaccaggatcagactccaagtcgtccagtgtccccggaaaccaatctaaataggact
gggcctgtacctgcaccggatccggaccaggtgggacgcaggcccacctctttgcgtcct
gatacttgcccactgcctggccctggagaaccaagccccaggagtaagcaggacgggccc
cctctgcagcacctgttggggaacggtctgaactactgtgtgcggtacatgggctgcatt
gaagtgctacaatcaatgaggtcactggattttggaatgagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccccggggcccatggagccattaaaaaacgaaag
gctcccgttaagttcctgacaacggttcttggcaaaagcaatcttcagttttcaggaatg
aatataaaactgactgtttcaacaagcagcctcacactgatgaaccttgacaaccaacag
attattgcaaatcaccaaatgcaatcgatttcatttgcctctggaggggaccctgatacc
acagactatgttgcctatgtagctaaagatccagtcaaccaacgagcgtgccacatactg
gagtgtcgcagtggaatggcccaagacgtcataagcaccatagggcaggcctttgaactc
cggttcaaacagtacttgaaaaatccttccttgaacacttgggaaagggaggaggtgctt
gttgatggtgtccctgaagacagagaccatgactattacaactccatcccggggaagcag
ccacccgaaggcggcatttcagatgtgcgcatccaggctcaagctacagaccaaatggct
tactgccctatccggtgtgaaaagttgtgctatttgcctgggaactccacgtgcagcggt
gtgtataagaactgtatgggacggagcaggccaataggtatcccgcacgagagagtgggg
cagggtgacgcaccatcgctgaggcacttctggagagtggatctctttgacgacccttgc
tatgtcaatacacaggctcttcagagtatgcacagctatgctggaaatcaaagctcagct
ctgccacaggggagcccctggcacctcggaaaggcaccagaaactgtgcagccgggagcc
acggccaagcctgggagcacactcgctttgccacacattaggcagcagctgtgggacgag
gagtgcttccatggcaagctgagcagaggggcagcggagaaacttttggtgaaggatggg
gactttttggttcgagagagtgtgacatctcccggccagtttgtactgagtggactgcaa
ggtggccaggccaagcatcttctcttggtggatccggaaggcaaggtgaggaccaaggac
catgtgtttgataatgttggccaccttatcaaataccatatggataataatttgccaatc
atctcttctggaagtgaagtacgccttaaacaaccaataagaaaatatgataacacagga
cttttgccccccaagaaatga

KEGG   Mus caroli (Ryukyu mouse): 110290710
Entry
110290710         CDS       T05910                                 

Gene name
Shc1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04510  Focal adhesion
mcal04650  Natural killer cell mediated cytotoxicity
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05034  Alcoholism
mcal05100  Bacterial invasion of epithelial cells
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05220  Chronic myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110290710 (Shc1)
   04014 Ras signaling pathway
    110290710 (Shc1)
   04072 Phospholipase D signaling pathway
    110290710 (Shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110290710 (Shc1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110290710 (Shc1)
   04062 Chemokine signaling pathway
    110290710 (Shc1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110290710 (Shc1)
   04915 Estrogen signaling pathway
    110290710 (Shc1)
   04917 Prolactin signaling pathway
    110290710 (Shc1)
   04926 Relaxin signaling pathway
    110290710 (Shc1)
   04935 Growth hormone synthesis, secretion and action
    110290710 (Shc1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110290710 (Shc1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110290710 (Shc1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110290710 (Shc1)
   05226 Gastric cancer
    110290710 (Shc1)
   05214 Glioma
    110290710 (Shc1)
   05220 Chronic myeloid leukemia
    110290710 (Shc1)
   05224 Breast cancer
    110290710 (Shc1)
  09165 Substance dependence
   05034 Alcoholism
    110290710 (Shc1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110290710 (Shc1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110290710 (Shc1)
   01522 Endocrine resistance
    110290710 (Shc1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 110290710
NCBI-ProteinID: XP_021013007
Ensembl: MGP_CAROLIEiJ_G0025210
UniProt: A0A6P5PED9
LinkDB
Position
3
AA seq 579 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGLLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAARPTLPSAQMSSHLGATLPIGQHAAGDHEVRKQMLPPPPCPGRELFDD
PSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMKPFEDALRVPPPLQSMSMAEQLQ
GEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRT
KDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKV
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggatcttctaccccccaagccgaagtacaacccacttcggaatgagtctttgtcatcg
ctggaggagggggcttcggggtctacccctccggaggagctaccttccccatcagcttca
tccctgggacccattctgcctcctctgccgggggacgatagtccgactaccctgtgttcc
ttctttccccggatgagcaacctgaagctggccaatcctgctggggggcgcctggggcct
aaaggggagccaggaaaggctgctgaagatggggaagggagtgcaggggcagcccttcgg
gactcaggcctcttgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtagaagggggccagctggggggcgaggagtggaccagacacgggagcttt
gtcaataagcccacacgaggctggctgcatcccaacgacaaagtcatgggacctggggtt
tcctacttggttcggtacatgggctgtgtggaggtcttacagtcaatgcgagcccttgac
ttcaatacccggactcaggtcaccagggaggccatcagtttggtgtgtgaagctgtgcct
ggtgccaaaggggcgacaaggaggagaaagccttgtagccgcccactcagctccatcctg
gggaggagtaacctgaagtttgctggaatgccaatcactctcactgtgtctaccagcagc
cttaacctcatggcagccgactgcaaacagatcattgccaaccatcacatgcaatctatc
tcattcgcgtccggtggggatccggacacagctgagtatgttgcctatgttgccaaagac
cctgtgaatcagagagcctgccatatcctggagtgtcctgaagggcttgctcaggatgtc
atcagcaccatcggacaggcctttgagttgcgcttcaaacagtatctcaggaacccgccg
aagctggtcaccccccatgacaggatggctggctttgatggttcagcttgggatgaggag
gaagaagagccccctgaccatcagtactacaatgactttccagggaaggaaccccctctt
ggtggggtggtagatatgaggcttcgggaaggggctgctcgacccactctgcctagtgcc
cagatgtccagccacttgggagctacactgcctatagggcagcatgctgcaggagaccac
gaagtccgtaaacagatgctgcctccgccgccttgcccaggcagagaactcttcgatgac
ccctcctatgtcaacatccagaatctagacaaggcccggcaggctgggggtggggctggg
cccccaaatccttctcttaatggcagtgcaccccgagacctttttgacatgaagcccttt
gaagatgcacttcgggtgccacccccactgcagtccatgtccatggctgagcagctgcaa
ggggagccctggttccatgggaagctgagccggcgggaggccgaggcgctgctgcagctc
aatggtgacttcttggtgcgagagagcacgaccacgcctggccagtatgtgctcaccggc
ctgcagagtgggcagcccaagcacttgctgctggtggaccctgaaggtgtggttcggaca
aaggatcaccgctttgagagtgtcagtcacctgatcagctaccacatggacaatcacttg
cccatcatctctgcgggcagcgaactgtgcctacagcaacccgtggatcggaaagtgtga

KEGG   Mus caroli (Ryukyu mouse): 110303444
Entry
110303444         CDS       T05910                                 

Gene name
Shc2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04650  Natural killer cell mediated cytotoxicity
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05034  Alcoholism
mcal05100  Bacterial invasion of epithelial cells
mcal05214  Glioma
mcal05220  Chronic myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110303444 (Shc2)
   04014 Ras signaling pathway
    110303444 (Shc2)
   04370 VEGF signaling pathway
    110303444 (Shc2)
   04072 Phospholipase D signaling pathway
    110303444 (Shc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110303444 (Shc2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110303444 (Shc2)
   04062 Chemokine signaling pathway
    110303444 (Shc2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110303444 (Shc2)
   04915 Estrogen signaling pathway
    110303444 (Shc2)
   04917 Prolactin signaling pathway
    110303444 (Shc2)
   04926 Relaxin signaling pathway
    110303444 (Shc2)
   04935 Growth hormone synthesis, secretion and action
    110303444 (Shc2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110303444 (Shc2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110303444 (Shc2)
   05226 Gastric cancer
    110303444 (Shc2)
   05214 Glioma
    110303444 (Shc2)
   05220 Chronic myeloid leukemia
    110303444 (Shc2)
   05224 Breast cancer
    110303444 (Shc2)
  09165 Substance dependence
   05034 Alcoholism
    110303444 (Shc2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110303444 (Shc2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110303444 (Shc2)
   01522 Endocrine resistance
    110303444 (Shc2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 110303444
NCBI-ProteinID: XP_021030201
Ensembl: MGP_CAROLIEiJ_G0015530
UniProt: A0A6P5QJU7
LinkDB
Position
10
AA seq 573 aa
MTQGPGGRAAPEPEAPTTFCALLPRMPQWKFAAPGSFLGRGPAAARVAGVAEAQPEPGVP
ALAAVLGACEPRCAAPCPLPALGRCRGSGTRGARVTPDVADEWVRKGGFIHKPAHGWLHP
DARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAP
NKALASILGKSNLRFAGMSISVNISVDGLNLSVPATRQIIANHHMQSISFASGGDTDMTD
YVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFELRFKQYLHSPPKAVVPPERLTGL
EELAWGDDETAADHNYYNSIPGKEPPLGGLVDSRLAVTQPCALATLGGLGQGMTPAWRDA
RGLPWDMGPSGAAPPGDGYVQADARGPHDYEEHLYVNTQGLDAVELEDIAEAPLQLEDSP
KKDLFDMRPFEDALKLHACSVAAGITAAPPPLEDQWPSPPTRRAPIAPTEEQLRQEPWYH
GRMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFE
SISHLIDYHLKNGLPIVAAESELHLRGVVSREP
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggtggccgcgcggcccccgagcccgaggcgcccaccaccttctgc
gcactgctgccgcggatgccgcagtggaagttcgcagcgccgggtagcttcctgggccgt
ggtcccgcagcggcgcgcgtggcgggggtggcagaggcgcagccggagcccggggtcccc
gcgctggccgctgtgctgggcgcttgcgaaccgcgctgcgccgcgccctgtccgctgccc
gctctcggccgctgccggggctcggggacgcgcggcgcgcgggtgactccggatgtcgcc
gacgagtgggtgcgcaagggcggcttcattcacaagccggcgcacggctggctgcacccc
gatgccagggtcctggggcccggggtctcttacatcgttcggtacatgggctgcattgag
gtgcttcgatccatgcgctccctggatttcaacacccgaacacaggtgacgagggaagcc
atcaatcggctccatgaggctgtgcccggtgtccggggctcctggaagaagaaggccccc
aacaaggctctggcctccatcttggggaaaagcaacctgcgcttcgccggcatgagcatc
tcagtcaacatctccgtggacggccttaacttgtctgttcctgccacccgccagatcatc
gccaaccatcatatgcagtctatttccttcgcctcgggtggtgacacggacatgactgat
tatgtggcctatgtggccaaggaccccatcaaccagagagcctgccacatcttggaatgc
tgtgaaggtcttgcccagagcgtcatcagcaccgtagggcaagcctttgagctgcgcttc
aagcaatacctgcacagcccacccaaggctgtagtgccccctgaaaggctgactgggctg
gaggagttggcctggggagatgatgagactgctgcagaccacaattactacaacagcatt
ccaggaaaggagccacctctgggcgggctggtggactccagactggctgtcacacagccc
tgtgcactggcgacactcggaggccttggacagggaatgacaccagcatggagagatgcc
cgtggcttgccttgggacatgggcccctctggtgcagccccaccgggggatggctacgtg
caggcagatgcccgagggccacatgactacgaggagcacctgtatgtcaatacccagggc
ctggatgctgtggagcttgaggacatcgctgaggcacctctacagcttgaggacagcccc
aagaaggacctgtttgacatgcgaccctttgaagatgccctgaagttgcacgcgtgctca
gtggcagccggcatcactgcagccccaccccctctggaggaccagtggcccagcccccct
acccgcagggcccccattgcacccacagaggagcaattgaggcaggagccctggtaccac
ggacgaatgagccgtcgggctgcagagaagctgcttcgggccgatggggacttccttgtg
agagacagcgtcaccaacccggggcagtatgtcctcacaggcatgcacgcggggcagccc
aagcacctgctgctggtggaccccgagggtgtggtgcggacgaaagatgtgttgtttgag
agcatcagccacctcatagactatcacctgaagaacgggctgcccatcgtggctgctgag
agcgagctgcatctgcggggagtggtctctcgggagccatga

KEGG   Mus caroli (Ryukyu mouse): 110308134
Entry
110308134         CDS       T05910                                 

Gene name
Shc3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04062  Chemokine signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04510  Focal adhesion
mcal04650  Natural killer cell mediated cytotoxicity
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05034  Alcoholism
mcal05100  Bacterial invasion of epithelial cells
mcal05214  Glioma
mcal05220  Chronic myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110308134 (Shc3)
   04014 Ras signaling pathway
    110308134 (Shc3)
   04072 Phospholipase D signaling pathway
    110308134 (Shc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110308134 (Shc3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110308134 (Shc3)
   04062 Chemokine signaling pathway
    110308134 (Shc3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110308134 (Shc3)
   04915 Estrogen signaling pathway
    110308134 (Shc3)
   04917 Prolactin signaling pathway
    110308134 (Shc3)
   04926 Relaxin signaling pathway
    110308134 (Shc3)
   04935 Growth hormone synthesis, secretion and action
    110308134 (Shc3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110308134 (Shc3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110308134 (Shc3)
   05226 Gastric cancer
    110308134 (Shc3)
   05214 Glioma
    110308134 (Shc3)
   05220 Chronic myeloid leukemia
    110308134 (Shc3)
   05224 Breast cancer
    110308134 (Shc3)
  09165 Substance dependence
   05034 Alcoholism
    110308134 (Shc3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110308134 (Shc3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110308134 (Shc3)
   01522 Endocrine resistance
    110308134 (Shc3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 110308134
NCBI-ProteinID: XP_021036164
UniProt: A0A6P5QZG4
LinkDB
Position
13
AA seq 594 aa
MLPRTKYNRFRNDSVTSVDDLLHSLSVSGSGGKVSAEPAASPYLVSGEALRKAPDDGPGS
LGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGGSATPGSRAPAAS
MSATRKSRAGDEPLPRPPRSAPHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQV
TREAISRVCEAVPGAKGALKKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPD
SKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQA
FELRFKQYLQCPSKVPALQDRMQSLDEPWTEEEGDGPDHPYYNSIPTKMPPPGGFLDARL
KGRPHAPEAAQFAGKEQTYYQGRHLGDAFGEDWQRAPTRQGSLDIYSTPEGKTHMVPVGE
TPTYVNTQPVPPQVWPAATSSTESSPRKDLFDMKPFEDALRNQPLGPMLSKAASVECISP
VTPRAPDARMLEELNDEPWYQGEMSRKEAEALLLEDGDFLVRKSTTNPGSFVLTGMHNGQ
AKHLLLVDPEGTIRTKDRVFDSISHLINYHLKSGLPIVSAGSELCLQQPVERKP
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagcctgtcggtgagcggcagcggcggcaaggtctcggcggagcccgcggcg
agcccctacctggtgtcgggcgaggcgctgcgcaaggcgccggacgatgggcccggcagc
ctgggccacctgctccacaaggtgtcccacttgaaactctccagctccggcctgcgtggc
ctgtcgtcggccgcccgggagcgggcaggagcgcggctctcgggcagctgcagcgcgccc
agcctggcggccccggacggcggcagcgcgacccccgggtcccgcgccccggccgccagc
atgagtgccaccaggaagagccgggccggcgacgagccactgcccaggccccctcggagc
gcgccgcacgccagcgaccaggtgctggggccgggagtcacctatgtggtcaagtacttg
ggctgcatcgaagttctgcgctcaatgaggtctcttgacttcagtacaagaactcaggtt
accagggaagccatcagccgtgtctgcgaagctgtgccaggtgccaaaggagccctcaag
aagagaaagccgccgagtaagatgctgtccagcatcctggggaagagcaacctccagttc
gcagggatgagcatctccctgaccatctccaccgccagcctgaatctgcgcactcctgac
tccaaacagatcatagcgaaccatcacatgcggtctatctctttcgcctcagggggagac
ccggacacaacggactatgttgcctatgtcgctaaggaccctgtcaatcgcagagcttgc
cacattctggaatgctgtgacgggctagcccaagatgtcattggctccatcggacaagcc
tttgaactccggttcaaacagtatttgcagtgcccttccaaggttcctgctctccaggac
cgaatgcagagtctggatgagccgtggactgaagaagagggagatggccctgatcaccca
tactacaacagcattcccaccaagatgcctcccccaggggggtttctggatgctcgattg
aaaggcagaccccacgctcctgaggcagctcagtttgcaggaaaagagcaaacttattac
cagggaagacacttaggagatgcatttggtgaagactggcagcgagcacccaccaggcaa
ggctccttggacatctatagcacaccagaagggaaaactcacatggttcctgtaggagaa
acaccaacctatgtcaacacccagccagtcccaccacaggtgtggccagcagcaaccagc
agcaccgagagcagcccacggaaggacctctttgacatgaagccttttgaagatgccctg
agaaaccagcccctgggccccatgttgagcaaagccgcgtctgtggagtgcatcagccca
gtcacgcccagagccccggatgccaggatgctggaggagcttaacgatgagccctggtac
caaggagagatgagcaggaaggaggcagaggccctgctactggaagatggagacttccta
gtcaggaagagtaccaccaaccccggctcctttgtcctcacgggcatgcacaatgggcag
gccaagcacctgctgctggtggacccggaaggcacgatccggacgaaggacagggtcttt
gacagcatcagccacctcatcaattaccacctcaagagcggcctgcccattgtctctgcc
gggagtgagctttgtctccagcaaccagtggagaggaaaccctga

DBGET integrated database retrieval system