KEGG   Mus caroli (Ryukyu mouse): 110289943
Entry
110289943         CDS       T05910                                 

Gene name
Traf1
Definition
(RefSeq) TNF receptor-associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04064  NF-kappa B signaling pathway
mcal04210  Apoptosis
mcal04668  TNF signaling pathway
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110289943 (Traf1)
   04668 TNF signaling pathway
    110289943 (Traf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110289943 (Traf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289943 (Traf1)
   05202 Transcriptional misregulation in cancer
    110289943 (Traf1)
   05203 Viral carcinogenesis
    110289943 (Traf1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110289943 (Traf1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd HypA
Other DBs
NCBI-GeneID: 110289943
NCBI-ProteinID: XP_021012022
Ensembl: MGP_CAROLIEiJ_G0023473
UniProt: A0A6P7QWR6
LinkDB
Position
2
AA seq 409 aa
MASSSAPDENEFQFGCPPAPCQDPSEPRVLCCTACLSENPRDDEDRICPKCRADNLQPVS
PGSPLTQEKVHPDVAEAEIMCPFAGVGCSFKGNPQSMQEHEATSQSSHLYLLLAVLKEWK
SSPGSNLGSAPMALERNLSELQLQAAVEATGDLEVDCYRAPCCESQEELALQHLVKEKLL
AQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVVELQQTLAQKD
QVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCL
RLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLS
SASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDTSA
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcctccagctcagcccctgatgaaaacgagtttcaatttggttgcccccctgctccc
tgccaggacccatcggagcccagagttctctgctgcacagcctgtctctctgagaaccca
agagatgatgaggatcggatctgtcctaaatgcagagcagacaacctccaacctgtgagc
ccaggaagccctctgactcaggagaaggttcaccctgatgtagctgaggctgaaatcatg
tgtccctttgcaggtgttggctgttccttcaaggggaacccacaatccatgcaggagcat
gaggctacctcccagtcctcccacctatatctgctgctggcggtcttaaaggagtggaaa
tcctcaccaggctccaacctagggtctgcacccatggcactggagcggaacctgtcagag
ctgcagcttcaggcagctgtggaagcgacaggggacctggaggtagactgctaccgggca
ccttgctgtgagagccaggaagaactggccctgcagcacttggtgaaagagaagctgctg
gctcagctggaggagaagctgcgtgtgtttgcaaacatcgttgctgtcctcaacaaggaa
gtggaggcttcccacctggcactggccgcctccatccaccagagccagttggaccgagag
cacatcctgagcttggagcagagggtggtggaattacagcaaaccctggcacaaaaagac
caggtcctgggcaagcttgagcacagtctgcgactcatggaggaggcatcctttgatggt
accttcctgtggaagatcaccaatgtcaccaagcggtgccacgagtcagtgtgtggccgg
acagtcagcctcttctctccagctttctacactgccaagtatggttacaagttgtgcctg
cgcttgtacctgaacggggatggctcaggcaagaagacccacctgtccctcttcatcgtg
atcatgagaggagaatatgatgctctcctgccctggcctttccggaacaaggtcaccttt
atgctacttgaccagaacaaccgagagcatgctattgatgccttccggccagatctgagc
tcagcctccttccagcggccacagagtgagaccaacgtggccagcggctgcccactcttc
ttccccctcagcaagctgcagtcacccaagcacgcctacgtcaaagatgacacaatgttc
ctcaaatgcattgtggacactagtgcttag

KEGG   Mus caroli (Ryukyu mouse): 110289986
Entry
110289986         CDS       T05910                                 

Gene name
Traf2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04210  Apoptosis
mcal04217  Necroptosis
mcal04380  Osteoclast differentiation
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04932  Non-alcoholic fatty liver disease
mcal05010  Alzheimer disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05160  Hepatitis C
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110289986 (Traf2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110289986 (Traf2)
   04064 NF-kappa B signaling pathway
    110289986 (Traf2)
   04668 TNF signaling pathway
    110289986 (Traf2)
   04071 Sphingolipid signaling pathway
    110289986 (Traf2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110289986 (Traf2)
   04217 Necroptosis
    110289986 (Traf2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110289986 (Traf2)
   04622 RIG-I-like receptor signaling pathway
    110289986 (Traf2)
   04657 IL-17 signaling pathway
    110289986 (Traf2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110289986 (Traf2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110289986 (Traf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289986 (Traf2)
   05203 Viral carcinogenesis
    110289986 (Traf2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110289986 (Traf2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110289986 (Traf2)
   05014 Amyotrophic lateral sclerosis
    110289986 (Traf2)
   05016 Huntington disease
    110289986 (Traf2)
   05017 Spinocerebellar ataxia
    110289986 (Traf2)
   05022 Pathways of neurodegeneration - multiple diseases
    110289986 (Traf2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110289986 (Traf2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110289986 (Traf2)
   05135 Yersinia infection
    110289986 (Traf2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110289986 (Traf2)
   05160 Hepatitis C
    110289986 (Traf2)
   05168 Herpes simplex virus 1 infection
    110289986 (Traf2)
   05163 Human cytomegalovirus infection
    110289986 (Traf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110289986 (Traf2)
   05169 Epstein-Barr virus infection
    110289986 (Traf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110289986 (Traf2)
   04121 Ubiquitin system [BR:mcal04121]
    110289986 (Traf2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110289986 (Traf2)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110289986 (Traf2)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    110289986 (Traf2)
SSDB
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_4 MATH PIN_9 Cep57_CLD
Other DBs
NCBI-GeneID: 110289986
NCBI-ProteinID: XP_021012094
Ensembl: MGP_CAROLIEiJ_G0023281
UniProt: A0A6P7QZM6
LinkDB
Position
2
AA seq 508 aa
MAAASVTSPGSLDLLQPGFSKTLLGTRLEAKYLCSACRNILRRPFQAQCGHRYCSFCLTS
ILRCASILSSSGPQNCAACVHEGLYEEGVSILESSSAFPDNAARREVESLPAVCPNDGCT
WKGTLKEYESCHEGQCPFLLTECPACKGLIRLSEKEHHTEQECPKRSLSCQHCRAPCSHV
DLEVHYEVCPKFPLTCDGCGKKKIPREKFQDHVRACSKCRVLCRFHTVGCSEMVETENLQ
DHEVQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREV
ERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGV
FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVV
MKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFC
PVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggctgcagccagtgtgacttcccctggctccctagatctgctacagcctggcttctcc
aagaccctcctggggaccaggttagaagccaagtacctctgttcagcctgcagaaacatc
ctgcggaggcctttccaggcccagtgtgggcaccgctactgctccttctgcctgaccagc
atcctcaggtgtgcatccattctctccagctctgggcctcagaactgtgcggcctgtgtc
catgaaggcctgtatgaagaaggcgtttctattctagagagtagttcggcctttccagat
aacgctgcccgcagagaggtggagagcctgccagctgtctgtcccaatgatggatgcact
tggaaggggaccttgaaagaatacgagagctgccacgaaggacagtgcccattcctgctg
acagagtgtcctgcatgtaaaggcctgatccgcctcagcgagaaggagcaccacactgag
caggaatgccccaaaaggagcctgagctgccagcactgcagagcaccctgtagccacgtg
gacctggaggtacactatgaggtctgccccaagtttcccttaacctgtgatggctgtggc
aagaagaagatccctcgggagaagtttcaggaccatgttagagcatgcagcaaatgccgg
gttctctgcagattccacacagttggctgttcagagatggtggagactgagaacctgcag
gatcatgaggtgcagcggctacgggaacacctagccctactgctgagctcattcctggag
gcccaggcctccccgggaaccttgaaccaggtggggccagagctactccagcggtgccag
attttggagcagaagatagccacctttgagaacatcgtctgcgtcttgaaccgtgaagta
gagagggtagcagtgactgcagaggcttgtagccggcagcaccggctagaccaggacaag
attgaggccctgagtaacaaggtgcaacagctggagaggagcattggcctcaaggacctg
gccatggctgacctggagcagaaggtctccgagttggaagtatccacctatgatggggtc
ttcatctggaagatctctgacttcaccagaaagcgtcaggaagccgtagctggccggaca
ccggctatcttctccccagccttctacacaagcagatatggctacaagatgtgtctacgg
gtctacttgaatggcgacggcactgggcggggaactcatctgtctctcttcttcgtggtg
atgaaaggccccaatgatgctctgttgcagtggccttttaatcagaaggtaacattgatg
ttgctggaccataacaaccgggagcatgtgatcgacgcattcaggcctgatgtaacctcg
tcctccttccagaggcctgtcagtgacatgaacatagccagtggctgccccctcttctgc
cctgtgtccaagatggaggccaagaattcctatgtgcgggatgatgctatcttcatcaaa
gctattgtggacctaacaggactctag

KEGG   Mus caroli (Ryukyu mouse): 110290132
Entry
110290132         CDS       T05910                                 

Gene name
Traf6
Definition
(RefSeq) TNF receptor-associated factor 6
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal04140  Autophagy - animal
mcal04144  Endocytosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110290132 (Traf6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110290132 (Traf6)
   04064 NF-kappa B signaling pathway
    110290132 (Traf6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110290132 (Traf6)
   04140 Autophagy - animal
    110290132 (Traf6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110290132 (Traf6)
   04621 NOD-like receptor signaling pathway
    110290132 (Traf6)
   04622 RIG-I-like receptor signaling pathway
    110290132 (Traf6)
   04657 IL-17 signaling pathway
    110290132 (Traf6)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110290132 (Traf6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110290132 (Traf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290132 (Traf6)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110290132 (Traf6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110290132 (Traf6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110290132 (Traf6)
   05135 Yersinia infection
    110290132 (Traf6)
   05133 Pertussis
    110290132 (Traf6)
   05152 Tuberculosis
    110290132 (Traf6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110290132 (Traf6)
   05161 Hepatitis B
    110290132 (Traf6)
   05160 Hepatitis C
    110290132 (Traf6)
   05171 Coronavirus disease - COVID-19
    110290132 (Traf6)
   05162 Measles
    110290132 (Traf6)
   05168 Herpes simplex virus 1 infection
    110290132 (Traf6)
   05169 Epstein-Barr virus infection
    110290132 (Traf6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110290132 (Traf6)
   05140 Leishmaniasis
    110290132 (Traf6)
   05142 Chagas disease
    110290132 (Traf6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110290132 (Traf6)
   04121 Ubiquitin system [BR:mcal04121]
    110290132 (Traf6)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110290132 (Traf6)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110290132 (Traf6)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    110290132 (Traf6)
SSDB
Motif
Pfam: zf-TRAF TRAF6_Z2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-TRAF_2 SlyX zf-RING_5 Tropomyosin_1 DUF4455 Sina PspA_IM30 U-box DUF16 UPF0242 Spc29 Tropomyosin PKcGMP_CC ADIP TMF_DNA_bd TACC_C
Other DBs
NCBI-GeneID: 110290132
NCBI-ProteinID: XP_021012275
Ensembl: MGP_CAROLIEiJ_G0024003
UniProt: A0A6P7QU75
LinkDB
Position
2
AA seq 528 aa
MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSANTGNLSSSFMEEIQGYDVEFDP
PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNF
AKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDC
PRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPC
TFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPN
YEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYI
WKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTM
QGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYV
TFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgagtctcttaaactgtgagaacagctgcgggtccagccagtcgtccagtgactgctgc
gctgccatggccgcctcctgcagcgctgcagtgaaagatgacagcgtgagtgccaacacc
gggaacctctccagctccttcatggaggagatccagggctacgatgtggagtttgaccca
cctctggagagcaagtatgagtgccccatctgcttgatggctttacgggaagcagtgcaa
acaccatgtggccacaggttctgcaaagcctgcatcatcaaatccataagggatgcaggt
cacaagtgcccagttgacaatgaaatactgctggaaaatcaactgtttcctgacaatttt
gcaaagcgagagattctttccctgacggtaaagtgcccaaataaaggctgtttgcaaaag
atggaactgagacatctcgaggatcatcaagtacattgtgaatttgctctagtgaattgt
ccccagtgccaacgtcctttccaaaagtgccaggttaatacacacattattgaggattgt
cccaggaggcaggtttcttgtgtaaactgtgctgtgtccatggcatatgaagagaaagag
atccatgatcaaagctgtcctctggcaaatatcatctgtgaatactgtggtacaatcctc
atcagagaacagatgcctaatcattatgatctggactgcccaacagctccaatcccttgc
acattcagtgtttttggctgtcatgaaaagatgcagaggaatcacttggcacgacacttg
caagagaatacccagttgcacatgagactgttggcccaggctgttcataatgttaacctt
gctttgcgtccgtgcgatgccgcctctccatcccggggatgtcgtccagaggacccaaat
tatgaggaaactatcaaacagttggagagtcgcctagtaagacaggaccatcagatccgg
gagctgactgccaaaatggaaactcagagtatgtacgtgggcgagctcaaacggaccatt
cggaccctggaggacaaggttgccgaaatggaagcacagcagtgtaacgggatctacatt
tggaagattggcaactttgggatgcacttgaaatcccaagaagaggaaagacctgttgtc
atccatagccctggattctacacaggcagacctgggtacaagctgtgcatgcgcctgcac
cttcagttaccaacagctcagcgctgtgcaaactatatatccctttttgtccacacaatg
caaggagaatatgacagccacctcccctggcccttccagggtacaatacgccttacaatt
cttgaccagtctgaagcagttataaggcaaaaccacgaagaggtcatggacgctaaacca
gaactgcttgcctttcagcgacccacaatcccacggaaccccaaaggttttggctatgta
acctttatgcacctggaagccttaagacagggaaccttcattaaggacgatacattacta
gtgcgctgtgaagtctctacccgctttgacatgggtggccttcggaaggagggtttccag
ccacgaagtactgatgcaggggtgtag

KEGG   Mus caroli (Ryukyu mouse): 110296886
Entry
110296886         CDS       T05910                                 

Gene name
Traf5
Definition
(RefSeq) TNF receptor-associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04064  NF-kappa B signaling pathway
mcal04217  Necroptosis
mcal04621  NOD-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110296886 (Traf5)
   04668 TNF signaling pathway
    110296886 (Traf5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110296886 (Traf5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110296886 (Traf5)
   04657 IL-17 signaling pathway
    110296886 (Traf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110296886 (Traf5)
   05203 Viral carcinogenesis
    110296886 (Traf5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110296886 (Traf5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110296886 (Traf5)
   05168 Herpes simplex virus 1 infection
    110296886 (Traf5)
   05163 Human cytomegalovirus infection
    110296886 (Traf5)
   05169 Epstein-Barr virus infection
    110296886 (Traf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110296886 (Traf5)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    110296886 (Traf5)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-TRAF_2 zf-C3HC4_4 Sina zf-RING_UBOX Med4 zf-RING_6 zf-RING_2 zf-RING_5 TFA2_Winged_2 Exonuc_VII_L ATG16 Mod_r DUF4279
Other DBs
NCBI-GeneID: 110296886
NCBI-ProteinID: XP_021021347
Ensembl: MGP_CAROLIEiJ_G0015058
UniProt: A0A6P5Q426
LinkDB
Position
1
AA seq 558 aa
MAHSEEQAAVPCAFIRQNSGNSVSLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGC
GHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARI
ILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNL
QDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLQE
HERAALQDHMLLVLEKNYQLEQQISDLYQSLEQKESKIQQLAGTVKKFEKELKQFTQMFG
RNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLE
ASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREA
VEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIK
DDTLFLKVAVDLTDLEDL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggctcattcggaggagcaagcggctgtcccctgtgccttcatccgccagaactctggc
aactccgtttccttggactttgagcccgacacggagtaccagtttgtggagcagctggaa
gaacgctacaaatgtgccttctgccactcagtgcttcacaacccccatcagaccggctgc
gggcaccgcttctgccagcagtgcatccggtctctgagagaattgaactcggtgccgatc
tgcccggtggacaaggaggtcatcaagcctcaggaggtgttcaaagacaactgctgcaaa
agagaagttctcaatttacacgtctactgcaaaaacgcccccgggtgcaatgccaggatt
attctgggacgattccaggaccaccttcagcactgttccttccaagctgtgccctgccct
aatgagagctgccgggaagccatgctccggaaagacgtgaaagagcacctgagcgcatac
tgccggttccgagaggagaagtgcctttactgcaaaagggacatagtggtgaccaacctg
caggatcatgaggaaaactcgtgtcctgcgtacccagtgtcttgtcccaacaggtgtgtg
cagactattccaagagctagggtgaatgaacaccttactgtatgtcctgaggctgagcaa
gactgtccctttaagcactatggctgcactgtcaagggaaagcgggggaacttgcaggag
catgagcgggcagccctgcaggaccacatgcttctggttttagagaagaactaccaacta
gaacagcagatctctgatttatatcagagtctcgaacagaaggaaagcaagatccagcag
ctggcaggaaccgtgaagaagttcgaaaaggagcttaagcagttcacacagatgtttggc
agaaatggaactttcctctcaaatgtccaggctctcaccagtcacacggacaagtcagct
tggctggaagcgcaggtacggcagctgctacaaatagttaaccagcagccaagtcgactt
gatctgaggtctttggtggatgcggttgacagcgtgaaacagaggatcacccagctggaa
gccagtgaccagagattagttcttttagagggggagaccagcaagcacgatgcacacatt
aatatccacaaagcacagctgaataagaacgaagagcggtttaagcagctggagggcgcc
tgctacagtggcaaactcatctggaaggtgacagattacagggtgaagaagagggaggct
gtggaggggcacacagtgtccgtcttcagccagcctttctacaccagccgctgcggctac
cggctctgtgccagggcatacctgaacggggacgggtcagggaagggaacgcacctgtcc
ctgtactttgtggtgatgcgcggtgagtttgactcgctgctgcagtggccgttcaggcag
agggtgaccctgatgcttttggaccagagtggcaagaagaaccatattgtggagaccttc
aaagctgaccccaacagcagcagcttcaaaaggccagatggcgagatgaacattgcctct
ggctgtccccgctttgtgtcacactctactctggagaactccaagaacacctacattaaa
gacgacaccctgttcttgaaagtggccgtggatttaactgacttagaggatctgtag

KEGG   Mus caroli (Ryukyu mouse): 110305822
Entry
110305822         CDS       T05910                                 

Gene name
Traf4
Definition
(RefSeq) TNF receptor-associated factor 4
  KO
K09848  TNF receptor-associated factor 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04657  IL-17 signaling pathway
mcal05200  Pathways in cancer
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    110305822 (Traf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110305822 (Traf4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110305822 (Traf4)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-Nse zf-C3HC4_4 zf-RING_5 zf-TRAF_2 zf-RING_2 zf-RING_6 zf-C3HC4_3 zf-rbx1 Sina
Other DBs
NCBI-GeneID: 110305822
NCBI-ProteinID: XP_021033610
Ensembl: MGP_CAROLIEiJ_G0016790
UniProt: A0A6P5QWQ3
LinkDB
Position
11
AA seq 470 aa
MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLP
LDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWNGPLRHLQGHLNTCSFNVVPCPNRCPAK
LSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLL
AQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLK
DSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELE
ELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEG
THLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKP
GTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASVELPRKILS
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcccggcttcgactacaagttcctggagaagcccaagcggcggctgctgtgcccactg
tgcgggaagcccatgcgcgagcctgtgcaggtgtctacttgtggccaccgcttctgcgac
acctgcctgcaggagtttctcagtgaaggagtcttcaaatgccctgaggaccaacttcct
ctggactatgccaagatctacccagacccagagctggaggtccaggtgttaggcttggct
atccgctgcatccacagtgaggagggctgccgctggaacgggccacttcgtcatctacag
ggccacttgaacacttgcagcttcaatgtagtcccctgcccgaatcgctgcccagccaag
ctgagccggcgtgatctgcctgctcacctgcagcacgactgccctaagcgccgcctcaaa
tgtgaattctgtggctgtgacttcagtggggaggcctacgagagtcacgagggcgtgtgc
ccccaagagagtgtgtactgtgagaacaagtgtggggcccgcatgatgaggcgactgttg
gcccagcatgccacgtctgagtgccccaagcgcacccagccctgtgcctactgtaccaag
gaatttgtttatgacaccatccagagccaccagtaccagtgcccacgcctgcctgttccc
tgccccaaccaatgtggagtgggcactgtggcccgggaagacctgcccacccatctgaag
gatagctgcagcactgcctttgttctctgccctttcaaagagtctggctgtaagcacagg
tgccctaagctggcaatgggacgtcacgtggaggagagcgtaaagccacatctggctatg
atgtgtgccctggtgagccggcagcggcaagagctgcaggagctgcgaagagaactggaa
gagttatccataggcagcgatggagtgctcatctggaagattggcagttatgggcgtcgt
ctacaagaggccaaggccaagcctaacctggagtgcttcagcccagccttctatactcat
aagtacggctacaagctgcaggtatctgcattcctcaacggcaacggcagtggtgagggc
acacacctctccatctacatccgcgtcttgccgggcgcctttgacaatctccttgagtgg
ccctttgcccgccgggtcaccttctccttactggatcagagtgacccaggtttggctaag
ccccagcatgtcactgagaccttccaccctgatccaaactggaagaacttccagaagcct
ggcacgtggcgaggctccctggatgagagttctctgggcttcggctaccccaagttcatt
tcccaccaggacatccgaaagcggaattacgtgcgggatgatgcggttttcatccgtgcc
tctgtcgaactgccccggaagatcctcagctga

KEGG   Mus caroli (Ryukyu mouse): 110306954
Entry
110306954         CDS       T05910                                 

Gene name
Traf3
Definition
(RefSeq) TNF receptor-associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04064  NF-kappa B signaling pathway
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110306954 (Traf3)
   04668 TNF signaling pathway
    110306954 (Traf3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110306954 (Traf3)
   04621 NOD-like receptor signaling pathway
    110306954 (Traf3)
   04622 RIG-I-like receptor signaling pathway
    110306954 (Traf3)
   04657 IL-17 signaling pathway
    110306954 (Traf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110306954 (Traf3)
   05203 Viral carcinogenesis
    110306954 (Traf3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110306954 (Traf3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110306954 (Traf3)
   05160 Hepatitis C
    110306954 (Traf3)
   05171 Coronavirus disease - COVID-19
    110306954 (Traf3)
   05164 Influenza A
    110306954 (Traf3)
   05162 Measles
    110306954 (Traf3)
   05168 Herpes simplex virus 1 infection
    110306954 (Traf3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110306954 (Traf3)
   05169 Epstein-Barr virus infection
    110306954 (Traf3)
   05165 Human papillomavirus infection
    110306954 (Traf3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 ATG16 Crescentin MPS2 zf-C3HC4_2 Spc7 Spc29 Cast zf-RING_4 Tropomyosin_1 KxDL T3SSipB FliJ BLOC1_2 DUF1664 Exonuc_VII_L GAS DUF3450 SPATA24
Other DBs
NCBI-GeneID: 110306954
NCBI-ProteinID: XP_021034790
Ensembl: MGP_CAROLIEiJ_G0018127
UniProt: A0A6P7RYT9
LinkDB
Position
12
AA seq 567 aa
MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKAVEDKYKCEKCRLVLC
SPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQIYCRNEG
RGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCK
SQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVF
QGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIE
IERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRV
TELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWK
IRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGE
YDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT
VLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggagtcaagcaaaaagatggatgctgctggcacactgcagcctaacccacccctaaag
ctgcagcctgatcgcggcgcagggtccgtgctcgtgccggagcaaggaggctacaaggag
aagtttgtgaaggcggtggaagacaagtacaaatgcgagaagtgccgcctggtgctgtgc
agcccgaagcagacggagtgtggccaccggttctgcgagagctgcatggccgccctgctg
agctcctccagtccaaaatgcacagcgtgccaagaaagcatcatcaaagacaaggtgttt
aaggataattgctgcaagagggagattctggcccttcagatctactgtcggaatgaaggc
agaggttgtgcggagcagctgactctgggacatctgctggtgcacctaaaaaatgaatgt
cagtttgaggaacttccctgtctgcgtgctgactgcaaagaaaaagtactgagaaaagac
ttacgggatcacgtggaaaaggcctgtaaataccgcgaggccacgtgcagtcactgcaag
agccaagtgcccatgatcaaactgcagaaacacgaagacacggattgtccctgcgtggtg
gtgtcctgccctcacaagtgcagcgttcagactcttctaaggagtgagttgagtgcacac
ttgtccgagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgttttt
cagggtacaaaccagcagatcaaggcccatgaggccagctccgcggtacagcacgtgaac
ctgctgaaggagtggagcaactccctggagaagaaggtttccctactgcagaatgaaagt
gttgagaaaaacaagagcatacaaagcctgcacaaccagatctgcagctttgagatcgag
attgagaggcagaaggagatgctccgaaacaacgagtccaagatccttcacctgcagcgg
gtaatcgacagccaagcagagaaactgaaagaactggacaaggagatccgtcccttccgg
cagaactgggaggaagcggacagcatgaagagcagtgtggagtccctccagaaccgagtg
actgagctggagagcgtagacaaaagtgcggggcaggccgctcgcaacacaggcttgctg
gagtcccagctgagccggcatgaccagatgttgagtgttcatgacatccgcttggccgac
atggacctgcggttccaggtcctcgaaaccgccagctacaatggggtgctgatctggaag
atccgtgactacaagcgccggaagcaggaggctgtcatggggaagaccctgtctctctac
agccagcctttctacacaggttattttggctataagatgtgtgccagggtctacctgaat
ggggacggaatggggaaagggacacacttgtcgctgttttttgtcattatgcgtggagaa
tatgatgctctgttgccatggccgttcaagcagaaagtgacacttatgctgatggatcag
gggtcctctcgccgtcatctgggagatgcgttcaagcccgaccccaacagcagtagcttc
aagaaacccaccggagagatgaatatcgcctctggctgcccagtctttgtcgcccaaact
gttctagagaacgggacgtatattaaagatgatacaatttttattaaagtcatagtggat
acctcggatctgcctgacccctga

DBGET integrated database retrieval system