KEGG   Mus caroli (Ryukyu mouse): 110289983
Entry
110289983         CDS       T05910                                 

Gene name
E2f1
Definition
(RefSeq) transcription factor E2F1 isoform X1
  KO
K17454  transcription factor E2F1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04110  Cell cycle
mcal04137  Mitophagy - animal
mcal04218  Cellular senescence
mcal04934  Cushing syndrome
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05212  Pancreatic cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110289983 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    110289983 (E2f1)
   04218 Cellular senescence
    110289983 (E2f1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110289983 (E2f1)
   05206 MicroRNAs in cancer
    110289983 (E2f1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110289983 (E2f1)
   05225 Hepatocellular carcinoma
    110289983 (E2f1)
   05226 Gastric cancer
    110289983 (E2f1)
   05214 Glioma
    110289983 (E2f1)
   05220 Chronic myeloid leukemia
    110289983 (E2f1)
   05218 Melanoma
    110289983 (E2f1)
   05219 Bladder cancer
    110289983 (E2f1)
   05215 Prostate cancer
    110289983 (E2f1)
   05224 Breast cancer
    110289983 (E2f1)
   05222 Small cell lung cancer
    110289983 (E2f1)
   05223 Non-small cell lung cancer
    110289983 (E2f1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110289983 (E2f1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110289983 (E2f1)
   05161 Hepatitis B
    110289983 (E2f1)
   05160 Hepatitis C
    110289983 (E2f1)
   05163 Human cytomegalovirus infection
    110289983 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110289983 (E2f1)
   05169 Epstein-Barr virus infection
    110289983 (E2f1)
   05165 Human papillomavirus infection
    110289983 (E2f1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110289983 (E2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110289983 (E2f1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110289983 (E2f1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 110289983
NCBI-ProteinID: XP_021012088
Ensembl: MGP_CAROLIEiJ_G0024513
UniProt: A0A6P5PCU2
LinkDB
Position
2
AA seq 433 aa
MALAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQLPAGPAAPPTGPRDPD
VLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSP
GEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLISK
KSKNHIQWLGSHTMVGIGKRLEGLTQDLQQLQESEQQLDHLMHICTTQLQLLSEDSDTQR
LAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEES
ADGISPGKTSCQETSSGEDRTADSGPAGPPPSPPSTSPALDPSQSLLGLEQEAVLPRMGH
LRVPMEEDQLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPHEALDYHFGLEEGEGIRDL
FDCDFGDLTPLDF
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggccttagcccccgcgggcggccagcacgcgccagcgctggaggccctgctcggggcg
ggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctctaccgcgcccgatgtc
ggcgccccgcagctccctgccggccccgccgcgccgcccactggccctcgcgatcctgac
gtgctgctcttcgccacgccgcaggcgccccgacccgcgcctagtgcaccgcgcccggct
ctcggccgcccgccggtgaaacggaggctggatctggaaactgaccatcagtacctggct
ggtagcagtgggccattccggggaagaggccgccacccagggaaaggtgtgaaatctccg
ggggagaagtcacgctatgaaacctcactaaatctgaccaccaaacgcttcttggagctg
ctgagccgctcagctgacggtgttgttgacctgaactgggcagctgaggtgttgaaggtg
cagaaacggcgcatctatgacatcaccaatgtcctggagggcatccagctcatatccaag
aagtccaagaatcatatccagtggctaggcagccacaccatggtggggatcggtaagcgg
cttgaaggcctgacccaggacctgcagcaactgcaggagagtgagcagcagctggaccac
ctgatgcacatctgtaccacacagctgcagctgctttccgaggactccgacacccagcgc
ctggcctatgtgacctgccaggaccttcgcagcatcgcagaccctgcagaacagatggtc
atagtgatcaaggcccctccggagacccagctccaagctgtggattcttcagagacattt
cagatctcccttaagagcaaacaaggccccattgatgttttcctgtgccctgaggagagt
gcggacgggattagccctgggaagacctcatgccaggagacatcctctggggaggacagg
actgcagactctggcccagcagggcctccaccatcacctccctccacatccccagccttg
gatcccagtcaatccctgttgggcctggagcaagaagcagtattgccacggatgggccac
ctgagggtccccatggaagaggaccaactgtcaccactggtggctgctgactcactcctg
gagcatgttaaagaagacttctctgggctcctccctggggagttcatcagcctctcccca
ccccacgaggcccttgactatcactttggtctcgaggagggtgagggcattagagatctc
tttgactgtgactttggggacctgacccctctggatttctga

DBGET integrated database retrieval system