KEGG   Mus caroli (Ryukyu mouse): 110290092
Entry
110290092         CDS       T05910                                 

Gene name
Nr1h3
Definition
(RefSeq) oxysterols receptor LXR-alpha isoform X1
  KO
K08536  liver X receptor alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03320  PPAR signaling pathway
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    110290092 (Nr1h3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110290092 (Nr1h3)
   04931 Insulin resistance
    110290092 (Nr1h3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110290092 (Nr1h3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110290092 (Nr1h3)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110290092 (Nr1h3)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110290092 (Nr1h3)
Nuclear receptors [BR:mcal03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   110290092 (Nr1h3)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110290092
NCBI-ProteinID: XP_021012235
Ensembl: MGP_CAROLIEiJ_G0023955
UniProt: A0A6P5PCR1
LinkDB
Position
2
AA seq 445 aa
MSLWLEASMPDVSPDSATELWKTEPQDAGDQGGNTCILREEARMPQSTGGALGIGLESAE
PTALLPRAETLPEPTELRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFF
RRSVIKGARYVCHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQ
EEEQAQATSVSPRVSSPPQVLPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPIAP
DPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLET
SRRYNPDSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAI
SIFSADRPNVQDQLQVERLQHTYVEALHAYVSINHPHDPLMFPRMLMKLVSLRTLSSVHS
EQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtccttgtggctggaggcctcaatgcctgatgtttctcctgattctgcaacggagttg
tggaagacagaacctcaagatgcaggagaccagggaggcaacacttgcatcctcagggag
gaagccaggatgccccaatcaactgggggtgctttagggatagggttggagtcagcagag
cctacagccctgctccccagggcagagaccctcccagagcctaccgagcttcgtccacaa
aagcggaaaaaggggccagcccccaaaatgctggggaacgagctgtgcagtgtctgtggg
gacaaagcctctggcttccattacaacgtgctgagctgtgagggctgcaagggattcttc
cgccgcagtgtcatcaagggagcacgctacgtctgccacagcggtggccactgccccatg
gacacctacatgcggcggaaatgccaggagtgtcgacttcgcaaatgccgccaggcaggc
atgagggaggagtgtgtgctgtcagaagaacagatccgcttgaagaaactgaagcggcaa
gaagaggaacaggctcaagccacatcggtgtccccaagggtgtcctcacctccacaagtc
ctgccacagctcagcccagagcagctgggcatgatcgagaagctggtggctgcccagcaa
cagtgtaacaggcgctccttctcggaccgcctgcgtgtcacgccttggcccattgcaccc
gaccctcagagccgggaagcccgccaacagcgctttgcccactttactgagctggccatc
gtgtccgtgcaggagattgttgactttgccaaacagctccctggcttcctacagctcagc
agagaggaccagatcgccttgctgaagacctctgcgatcgaggtgatgcttctggagact
tcacggaggtacaaccccgacagtgagagcattaccttcctcaaggacttcagttacaac
cgggaagactttgccaaagcagggctgcaggtggagttcatcaaccccatctttgagttc
tccagagccatgaatgagctgcaactcaatgatgctgagtttgctctgctcattgccatc
agcatcttctctgcagaccggcccaacgtgcaggaccagctccaggtagagaggctgcaa
cacacatatgtggaggccctgcacgcctacgtctccatcaaccacccccacgaccctctg
atgttcccacggatgctaatgaagctggtgagcctccggactttgagcagcgtccattca
gagcaagtgtttgcccttcgcctgcaggacaaaaagcttccccctctgctgtctgagatc
tgggatgtccacgagtga

DBGET integrated database retrieval system