KEGG   Mus caroli (Ryukyu mouse): 110290093
Entry
110290093         CDS       T05910                                 

Gene name
Ddb2
Definition
(RefSeq) DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03420  Nucleotide excision repair
mcal04115  p53 signaling pathway
mcal04120  Ubiquitin mediated proteolysis
mcal05161  Hepatitis B
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05216  Thyroid cancer
mcal05217  Basal cell carcinoma
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110290093 (Ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    110290093 (Ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    110290093 (Ddb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290093 (Ddb2)
   05202 Transcriptional misregulation in cancer
    110290093 (Ddb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110290093 (Ddb2)
   05212 Pancreatic cancer
    110290093 (Ddb2)
   05225 Hepatocellular carcinoma
    110290093 (Ddb2)
   05226 Gastric cancer
    110290093 (Ddb2)
   05214 Glioma
    110290093 (Ddb2)
   05216 Thyroid cancer
    110290093 (Ddb2)
   05220 Chronic myeloid leukemia
    110290093 (Ddb2)
   05217 Basal cell carcinoma
    110290093 (Ddb2)
   05218 Melanoma
    110290093 (Ddb2)
   05213 Endometrial cancer
    110290093 (Ddb2)
   05224 Breast cancer
    110290093 (Ddb2)
   05222 Small cell lung cancer
    110290093 (Ddb2)
   05223 Non-small cell lung cancer
    110290093 (Ddb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110290093 (Ddb2)
   05169 Epstein-Barr virus infection
    110290093 (Ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110290093 (Ddb2)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110290093 (Ddb2)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     110290093 (Ddb2)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      110290093 (Ddb2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 110290093
NCBI-ProteinID: XP_021012239
Ensembl: MGP_CAROLIEiJ_G0023957
UniProt: A0A6P5PGQ7
LinkDB
Position
2
AA seq 432 aa
MAPKKCPETQKSPDVAVLLRSKSRRGPQELEPEAKKLRVQGPVPSRTCESCCLLAELSSL
QIPSRSSSIVRNLYQHKLGKATWSSLQQGLQKSFLHSLASYQVFRKAAPFDRRTTSLAWH
PTHPSTLAVGSKGGDIMIWNFGIKDKPIFLKGIGAGGSITGLKFNHLNTNQFFASSMEGT
TRLQDFKGNILRVYTSSNSCKVWFCSLDVSAKSRVVVTGDNMGHVILLSTDGKELWNLRM
HKKKVAHVALNPCCDWLLATASIDQTVKIWDLRQIKGKDSFLYSLPHRHPVNAACFSPDG
ARLLTTDQNNEIRVYSASQWDSPLNLISHPHRHFQHLTPIKATWHSRHNLIVVGRYPDPN
LKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASTMGYHILIWSQ
EEDGSQKDHERL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggctcccaagaaatgcccagaaacccagaagtcccctgacgttgcggtgctcctcagg
agcaaaagtcgcagaggtcctcaggagctggagcccgaagccaagaagctgcgtgtgcag
ggtcccgttcctagcaggacatgtgagtcgtgctgccttctggcagagttgtccagcctg
cagatcccttcacggagtagcagcattgtcaggaatctttaccagcataagttgggcaaa
gccacctggtcatcactacagcagggtctgcagaagtcctttttgcactctctagcttct
taccaggtattccgaaaagctgccccctttgacaggaggactacatccttggcatggcac
ccgactcatcccagtaccctggctgtgggctccaaagggggagacattatgatctggaac
tttggcataaaggacaaacctatcttccttaaagggattggagctggaggaagcatcact
gggctgaagtttaaccatctcaataccaaccagttttttgcctcctcaatggagggaaca
accaggctgcaggattttaaaggcaacattctcagagtttataccagctcaaactcttgc
aaggtctggttttgcagccttgatgtttctgccaagagcagagtggtggttacaggagac
aatatgggacacgtgatcctgttgagcacagatggcaaggagctttggaacctcagaatg
cacaagaagaaagtagcccacgtggccctgaatccctgctgtgattggcttctggccaca
gcctccatagatcaaacagtgaagatttgggacctgcgccaaattaaagggaaagacagc
ttcctctactcactgcctcacaggcatcctgtcaatgcagcttgttttagcccagatgga
gctcggctcctgactactgaccagaacaatgagattcgggtttactctgcctcccagtgg
gatagccccctgaatctgatctcccaccctcaccgccattttcagcacctcacacccatc
aaggcgacctggcattcacggcacaacctcatcgttgtgggccgatacccagatcctaat
cttaaaagttgtgttccctatgaactgaggacaatagatgtgtttgatggaagctcaggg
aagatgatgtgtcagctctatgatccaggatactccggtattacttcgctcaatgagttc
aatcctatgggagacacactggcctctactatgggttatcatattctcatttggagccaa
gaggaagatgggtcacagaaagaccatgaaagactatga

DBGET integrated database retrieval system