KEGG   Mus caroli (Ryukyu mouse): 110290454
Entry
110290454         CDS       T05910                                 

Gene name
Plcg1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04072  Phospholipase D signaling pathway
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04613  Neutrophil extracellular trap formation
mcal04650  Natural killer cell mediated cytotoxicity
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04919  Thyroid hormone signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05012  Parkinson disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05135  Yersinia infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
mcal_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110290454 (Plcg1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110290454 (Plcg1)
   04014 Ras signaling pathway
    110290454 (Plcg1)
   04015 Rap1 signaling pathway
    110290454 (Plcg1)
   04370 VEGF signaling pathway
    110290454 (Plcg1)
   04064 NF-kappa B signaling pathway
    110290454 (Plcg1)
   04066 HIF-1 signaling pathway
    110290454 (Plcg1)
   04020 Calcium signaling pathway
    110290454 (Plcg1)
   04070 Phosphatidylinositol signaling system
    110290454 (Plcg1)
   04072 Phospholipase D signaling pathway
    110290454 (Plcg1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110290454 (Plcg1)
   04650 Natural killer cell mediated cytotoxicity
    110290454 (Plcg1)
   04660 T cell receptor signaling pathway
    110290454 (Plcg1)
   04658 Th1 and Th2 cell differentiation
    110290454 (Plcg1)
   04659 Th17 cell differentiation
    110290454 (Plcg1)
   04664 Fc epsilon RI signaling pathway
    110290454 (Plcg1)
   04666 Fc gamma R-mediated phagocytosis
    110290454 (Plcg1)
   04670 Leukocyte transendothelial migration
    110290454 (Plcg1)
   04062 Chemokine signaling pathway
    110290454 (Plcg1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110290454 (Plcg1)
   04919 Thyroid hormone signaling pathway
    110290454 (Plcg1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110290454 (Plcg1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110290454 (Plcg1)
  09158 Development and regeneration
   04360 Axon guidance
    110290454 (Plcg1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290454 (Plcg1)
   05206 MicroRNAs in cancer
    110290454 (Plcg1)
   05205 Proteoglycans in cancer
    110290454 (Plcg1)
   05231 Choline metabolism in cancer
    110290454 (Plcg1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110290454 (Plcg1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110290454 (Plcg1)
   05214 Glioma
    110290454 (Plcg1)
   05223 Non-small cell lung cancer
    110290454 (Plcg1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110290454 (Plcg1)
   05022 Pathways of neurodegeneration - multiple diseases
    110290454 (Plcg1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110290454 (Plcg1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110290454 (Plcg1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110290454 (Plcg1)
   05171 Coronavirus disease - COVID-19
    110290454 (Plcg1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110290454 (Plcg1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110290454 (Plcg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110290454 (Plcg1)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110290454 (Plcg1)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110290454 (Plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110290454 (Plcg1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 110290454
NCBI-ProteinID: XP_021012651
Ensembl: MGP_CAROLIEiJ_G0024600
UniProt: A0A6P5PEA9
LinkDB
Position
2
AA seq 1290 aa
MAGVATPCANGCGPGAPSEAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLETSALRT
GERPEHCQVSLSEFQQFLLEYQGELWAVDRLRVQEFMLSFLRDPLREVEEPYLFLDELVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETNSDQGNEDEEEPKEASS
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMINPAVLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MPSVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGISLRERASDASSQLFHVRGREGSFEARYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3873 nt   +upstreamnt  +downstreamnt
atggctggcgtcgcgaccccctgcgccaacggctgcgggcccggcgcgccctccgaagcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccagaacggaagaccttccaggtcaagttggagacgcgccagatc
acatggagccgcggcgcggacaaaatcgaggggtccattgatatccgagaaatcaaggag
atccgtccagggaagacgtcacgggactttgaccgctaccaagaagaccctgccttccgg
ccagatcaatcacactgctttgtcatcctctatggaatggaattccgcttgaagaccctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacactgcaggcagccacacccctgcaaattgagaggtggctccggaagcag
ttctactcagtggatcggaaccgagaggatcgtatatcagccaaggacttgaagaacatg
ctgtctcaggtcaactaccgagtccccaatatgcgcttcctccgagagcggctgacggac
cttgaacagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggaccttcccttcttggaaaccagcgctttgaggact
ggagagcggccggagcattgccaggtgtccctttctgagttccagcagttccttcttgaa
taccagggggagctgtgggctgtggaccggctccgggtgcaggaattcatgctcagcttc
cttcgagaccccttgcgagaggttgaggagccgtacttgttcttggatgagcttgtcacc
ttcctgttctccaaagagaatagtgtgtggaactcacagctggatgctgtgtgcccagac
accatgaacaacccactctctcactattggatctcctcctcacataatacgtacctgact
ggggaccagttctccagtgagtcctccctggaagcctatgctcgctgcctgaggatgggc
tgtcgctgcattgagttggactgctgggatgggccagatgggatgccagtcatttaccat
gggcacactctcaccaccaagatcaagttctctgacgtcctgcacaccatcaaggagcat
gctttcgtagcctccgagtacccagtcatcctgtccatcgaggaccactgcagcattgcc
cagcagagaaacatggctcagcacttcagaaaggtgcttggcgacacactccttaccaag
cctgtggacattgctgctgatgggcttccttctcccaaccagctcaagaggaagatcctt
attaagcacaagaagctggctgagggcagtgcctatgaggaggtgcctacctctgtgatg
tactccgagaatgacatcagtaactccatcaagaatggtatcctctacttggaggacccc
gtgaatcatgagtggtatccccactacttcgttctgacgagcagcaagatctactactct
gaggagaccaacagtgaccagggcaatgaggatgaagaggagccgaaggaggccagcagc
agcacagagctgcactcgagtgagaagtggttccacgggaagctcggggctggacgtgat
gggcggcacattgctgagcgcctgctcactgagtactgcatagagactggggctcctgat
ggctccttcctagtgcgagaaagtgagaccttcgtgggtgactacacgctgtccttctgg
cggaatgggaaagtccagcactgccgcatccattcccggcaggatgctgggactcctaag
ttcttcttgacagataaccttgtctttgactctctctatgacctcatcacacattatcag
caagtacccctgcgctgcaatgagtttgagatgcgcctttcagagcctgttccacagacg
aatgcccatgaaagcaaagagtggtaccatgcaagcctgactagagctcaggctgaacat
atgctgatgcgagtgccccgggatggggccttcctggtgcggaaacgcaatgagcctaac
tcatacgccatctctttccgggctgagggaaagatcaagcactgccgagtacagcaggaa
ggccagactgtgatgctggggaactctgagtttgacagcctggttgacctcatcagctac
tatgagaagcaccccctgtaccgcaaaatgaagctacgctaccccatcaacgaggaggca
ctggagaagattgggacagctgaacccgattatggggcactatatgagggccgcaaccct
ggtttctatgtggaggcaaaccctatgccaactttcaagtgtgcagtaaaagccctcttc
gactacaaggcccagagagaggatgagctgaccttcaccaagagtgccatcatccagaat
gtggaaaagcaagatggtggctggtggcgaggggactatggtgggaagaagcagctgtgg
ttcccctcaaactatgtggaagagatgatcaatccagcagtcctagagcctgagagggag
cacctggatgaaaacagcccactgggggacttgctgcgaggggtcttagatgtgccagct
tgtcagatcgcaatccgtcctgagggcaaaaacaaccggctcttcgtcttctccatcagc
atgccgtcagtggctcagtggtccctggatgttgcagctgactcacaggaggagttacag
gactgggtgaaaaagatccgtgaagttgcccagactgcagatgccaggctcactgagggg
aagatgatggagaggaggaagaagatcgccttggagctttccgagcttgtggtctactgc
cggcccgttccctttgatgaagagaagattggcacagaacgtgcttgttaccgggacatg
tcctcctttccggaaaccaaggctgagaagtatgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccggctgcagctctctcgcatctaccccaagggccagaggctggactcc
tccaattatgatcctctgcccatgtggatctgcggcagccagcttgtagcactcaatttc
cagaccccagacaagcctatgcagatgaaccaggccctcttcatggctggtgggcattgt
ggctatgtgctgcagccaagcaccatgagagacgaagcctttgacccctttgataagagc
agtctccgaggtctggaaccctgtgtcatttgcattgaggtgctgggggccaggcatctg
ccgaagaatggccggggtattgtgtgtccttttgtggagattgaggtggctggggctgag
tacgacagcaccaagcaaaagacggagtttgtagtggacaacggactgaaccctgtgtgg
cccgctaagcccttccacttccagatcagtaacccagagtttgcctttctgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaacttcttggctcaggctactttcccagta
aaaggcctgaagacaggatatagagcagtgcctttgaagaacaactacagtgaagacctg
gagttggcctccctgctcatcaagattgacattttccctgctaaggagaacggtgacctc
agtcctttcagtggcatatccctaagggaacgggcctcagatgcctccagccagctgttc
catgtccggggccgggaagggtcctttgaagccagataccagcagccatttgaagatttc
cgcatctcgcaggagcatcttgcagaccattttgacagtcgggaacgaagggccccaaga
aggactcgggtcaatggagacaaccgcctctag

KEGG   Mus caroli (Ryukyu mouse): 110300336
Entry
110300336         CDS       T05910                                 

Gene name
Plcg2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X1
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04020  Calcium signaling pathway
mcal04062  Chemokine signaling pathway
mcal04064  NF-kappa B signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04072  Phospholipase D signaling pathway
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04625  C-type lectin receptor signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04919  Thyroid hormone signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05214  Glioma
mcal05223  Non-small cell lung cancer
mcal05225  Hepatocellular carcinoma
Module
mcal_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110300336 (Plcg2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110300336 (Plcg2)
   04014 Ras signaling pathway
    110300336 (Plcg2)
   04370 VEGF signaling pathway
    110300336 (Plcg2)
   04064 NF-kappa B signaling pathway
    110300336 (Plcg2)
   04066 HIF-1 signaling pathway
    110300336 (Plcg2)
   04020 Calcium signaling pathway
    110300336 (Plcg2)
   04070 Phosphatidylinositol signaling system
    110300336 (Plcg2)
   04072 Phospholipase D signaling pathway
    110300336 (Plcg2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110300336 (Plcg2)
   04613 Neutrophil extracellular trap formation
    110300336 (Plcg2)
   04625 C-type lectin receptor signaling pathway
    110300336 (Plcg2)
   04650 Natural killer cell mediated cytotoxicity
    110300336 (Plcg2)
   04662 B cell receptor signaling pathway
    110300336 (Plcg2)
   04664 Fc epsilon RI signaling pathway
    110300336 (Plcg2)
   04666 Fc gamma R-mediated phagocytosis
    110300336 (Plcg2)
   04670 Leukocyte transendothelial migration
    110300336 (Plcg2)
   04062 Chemokine signaling pathway
    110300336 (Plcg2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110300336 (Plcg2)
   04919 Thyroid hormone signaling pathway
    110300336 (Plcg2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110300336 (Plcg2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110300336 (Plcg2)
  09158 Development and regeneration
   04360 Axon guidance
    110300336 (Plcg2)
   04380 Osteoclast differentiation
    110300336 (Plcg2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110300336 (Plcg2)
   05206 MicroRNAs in cancer
    110300336 (Plcg2)
   05205 Proteoglycans in cancer
    110300336 (Plcg2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110300336 (Plcg2)
   05214 Glioma
    110300336 (Plcg2)
   05223 Non-small cell lung cancer
    110300336 (Plcg2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110300336 (Plcg2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110300336 (Plcg2)
   05171 Coronavirus disease - COVID-19
    110300336 (Plcg2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110300336 (Plcg2)
   05169 Epstein-Barr virus infection
    110300336 (Plcg2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110300336 (Plcg2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110300336 (Plcg2)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110300336 (Plcg2)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110300336 (Plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110300336 (Plcg2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 GDPD EF-hand_like
Other DBs
NCBI-GeneID: 110300336
NCBI-ProteinID: XP_021026136
Ensembl: MGP_CAROLIEiJ_G0031610
UniProt: A0A6P5Q8L0
LinkDB
Position
8
AA seq 1265 aa
MTTMVNVDTLPEYEKSQIKRALELGTVMTVFNARKSTPERRTVQMIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRHKAECCFTILYGTQFVLSTLSLATDSKEDAV
KWLSGLKILHQEAMSASTPTMIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSGI
KFLKDKLVEIGAQKDELSFEQFHLFYKKLMFDQQKSILDEFKKDSSVFILGNTDRPDASA
VYLQDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRAGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFVTSSFPVILSIEEHCSVEQQRHMAKV
FKEVLGDMLLTKPTEASADQLPSPSQLREKIIIKHKKLGPKGDVDVNVEDKKDEHKPQGE
LYMWDSIDQKWTRHYCAIADAKLSFGDDIEQAVEEEPVQDTPPTELHFGEKWFHKKVESR
TCAEKLLQEYCAETGAKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMENGVMKYY
LTDNLTFNSIYALIQHYREAHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGTDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHTLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELTFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISAGDAEEMEKQII
EDNPLGSLCKGILDLNTYNVVKAPQGKNQKAFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKMDTKENNMKYWERNQSIAIELSDLVVYCKPTSKTKDHLENPDFREIRSFVE
TKADSIVRQKPVDLLRYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRSEKYDPMPLESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDSNKFKTTVVNDNGLSPVWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRGANRDALVKEFNVNENQLQLYQEKCNRRLREKRVSN
SRFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaccaccatggtcaacgtggacacccttccagaatatgagaagagtcagatcaagaga
gcgctggagttagggacggtgatgactgtgttcaacgcccgcaaatccaccccagagcgg
aggacagtacagatgatcatggagactcggcaggtggcatggagcaagaccgcggacaag
attgaaggcttcttggacatcatggagataaaggaaatccgtccggggaagaactccaag
gactttgagcgagccaaggctgtccgtcacaaggcagaatgttgcttcaccatcctctac
ggcacccagttcgtcctcagcacgctcagtttggcaacggactcgaaggaggatgcggtg
aagtggctctctggcttgaagatcctacaccaggaagccatgagtgcatccacccccaca
atgattgagagttggctgagaaaacagatttattcagtagatcaaacccgaagaaacagc
atcagcctccgggagctgaagaccatcttgccactggtcaacttcaaagtgagcggcatc
aagtttctcaaggacaagctggtggaaatcggtgcacagaaagatgagctcagctttgaa
cagttccatctcttctataagaaactcatgtttgaccagcaaaaatcgatacttgacgaa
ttcaaaaaggactcctccgtgttcatcctaggaaacacagaccggccggatgcctcggct
gtctacctgcaggacttccagaggtttcttttacatgaacagcaggagctatgggctcag
gatctgaacaaagtccgggagcggatgaccaagtttatcgatgacacaatgagagagact
gcagagcccttcttatttgtggatgagttcctcacgtatctgttctcccgggagaacagc
atctgggacgagaagtatgatgcagtggacatgcaggacatgaacaaccccttgtcccac
tactggatctcctcttcccacaacacgtacctcaccggggaccagctgcgtagtgagtcc
tccacggaagcgtatatccgctgtctgcgtgctggttgccgctgcattgagctggactgc
tgggacgggcctgacgggaagcccattatctaccacggctggacacggaccaccaagatc
aagtttgatgatgttgttcaggccatccgagaccacgcctttgttacctccagcttcccc
gtgatcttgtctatcgaggaacactgcagtgtggagcagcaacgtcacatggccaaggtg
ttcaaggaagtgttaggagacatgctgttgacgaagcccacagaggccagtgctgaccag
ctgccctcacccagtcagcttcgtgagaagatcattatcaagcataagaagctgggtccc
aagggtgacgtcgacgtcaatgtggaggacaagaaagatgagcacaagccccagggcgag
ctgtatatgtgggactccatcgaccagaaatggacgcgccactactgtgccattgctgac
gccaagttgtccttcggtgatgacattgaacaggctgtggaggaggagccggtccaggac
actccccccacggagctgcattttggggagaaatggttccataagaaggtggagagtagg
acctgtgcggagaagctgctgcaagagtactgtgccgagaccggggccaaggacggcacc
ttcctggtgcgggagagcgagaccttccccaacgactacacactctctttctggcggtct
ggccgggtgcagcactgccggatccggtctactatggagaatggggtcatgaagtactac
ctgactgacaacctcacgttcaacagcatctatgcccttatccagcactaccgcgaggca
cacctgcgctgtgcggagttcgagctgcggctcacagacccagtgcccaaccccaaccca
cacgagtccaagccgtggtactatgacagtctgagcaggggggaagcggaggacatgctg
atgcggatcccccgagatggagccttcctcatccggaagcgggaggggaccgactcctat
gccatcaccttcagggccaggggcaaggtgaaacattgtcgcatcaaccgggatggacgc
cacttcgtgctgggcacctctgcctactttgagagcctggtggagcttgtcagctactac
gagaagcatacactctatcgtaagatgcggcttcgataccctgtgaccccggagctcctg
gagcgatataatatggaaagagacatcaactctctctatgacgtcagcaggatgtatgtg
gacccaagtgagatcaacccttccatgcctcagaggaccgtgaaagcactctatgactac
aaagccaagcgcagcgatgagctgaccttctgccgcggtgccctcatccacaatgtctcc
aaggagcccgggggatggtggaaaggggactacgggacccggatccagcagtacttcccg
tccaactatgtcgaggatatctcggcaggagatgctgaggagatggaaaagcagattatt
gaagacaatcccctcgggtctctctgcaaaggcatattggatcttaatacctacaacgtt
gtgaaggccccccaggggaaaaaccagaaagccttcgtctttatcctggagcctaagaaa
cagggagatcctcccgtggagtttgcgaccgaccgtgtggaggagctgtttgagtggttt
cagagcatacgggagatcacttggaagatggacaccaaggagaacaacatgaagtactgg
gagaggaaccagtccatcgccattgagctctcggacttggttgtatactgcaagccaact
agcaaaaccaaggaccatttggaaaatcctgacttccgagaaatccgctcttttgtggag
acgaaggcagacagcattgtcaggcaaaaacctgtcgatctattgcggtacaatcagaag
ggcctgacccgcgtctaccccaagggacagagagttgactcttcgaactatgaccccttc
cgtctgtggctgtgtggctcccagatggtggcactcaatttccagactccagacaagtac
atgcagatgaaccacgcgctgttttcgctcaatgggcggacaggctacgtcctgcagccg
gagagcatgcgctctgagaagtatgacccgatgcccctggagtcccagaggaagatcctg
atgacactcactgtcaaggttcttggtgcacgccacctccctaaactagggcggagtatt
gcctgtccttttgtggaggtggaaatctgcggggctgagtatgacagcaacaaattcaag
acgacggttgtgaatgacaatggcctcagccctgtctgggctccaactcaggagaaggtg
acatttgaaatctatgatccaaaccttgccttcctacgctttgtggtctacgaagaagac
atgttcagtgaccccaacttcctggctcatgccacgtaccccattaaaggcatcaaatcc
ggctttagatcagtccctctgaagaatgggtacagtgaagacatcgaactggcatccctc
ctggttttctgtgagatgaggccagtcctggagagtgaagaggaactctattcctcctgt
cgccaactgcggaggcggcaagaagaactcaacaaccagctcttcctgtacgacacgcac
cagaacctgcgcggagccaaccgtgatgccctggtgaaggagttcaacgttaacgagaat
cagctgcagctctaccaggagaagtgcaaccggaggctgagagagaagagagtaagcaac
agcaggttctactcctag

DBGET integrated database retrieval system