KEGG   Mus caroli (Ryukyu mouse): 110290588
Entry
110290588         CDS       T05910                                 

Gene name
Rxrg
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03320  PPAR signaling pathway
mcal04659  Th17 cell differentiation
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05216  Thyroid cancer
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110290588 (Rxrg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110290588 (Rxrg)
   03320 PPAR signaling pathway
    110290588 (Rxrg)
   04919 Thyroid hormone signaling pathway
    110290588 (Rxrg)
   04928 Parathyroid hormone synthesis, secretion and action
    110290588 (Rxrg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290588 (Rxrg)
   05202 Transcriptional misregulation in cancer
    110290588 (Rxrg)
  09162 Cancer: specific types
   05226 Gastric cancer
    110290588 (Rxrg)
   05216 Thyroid cancer
    110290588 (Rxrg)
   05222 Small cell lung cancer
    110290588 (Rxrg)
   05223 Non-small cell lung cancer
    110290588 (Rxrg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110290588 (Rxrg)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110290588 (Rxrg)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110290588 (Rxrg)
Nuclear receptors [BR:mcal03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110290588 (Rxrg)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110290588
NCBI-ProteinID: XP_021012799
Ensembl: MGP_CAROLIEiJ_G0014827
UniProt: A0A6P5PI22
LinkDB
Position
1
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSSHEDMPVERIL
EAELAVEPKTEPYGDMNVENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattactcccacttcatgaagtttcccaccggctttggtggctcccctggt
cacactggctcgacgtccatgagcccttcagtagccttgcccacggggaagccaatggac
agccaccccagctacacagacaccccagtgagtgccccccggacgctgagtgctgtggga
acccccctcaatgctcttggctctccgtatagagtcatcacttctgccatgggtccaccc
tcaggagcactggcagctcctccaggaatcaacttggtagctccacccagctcccagcta
aatgtggtcaacagtgtcagcagctctgaggacatcaagcccttacctggtctgcctggg
attggaaatatgaactacccatccaccagccctgggtctctggtgaaacacatctgtgcc
atctgtggggacagatcctcagggaagcactacggtgtgtacagctgtgaaggttgcaaa
ggtttcttcaaaaggaccatcaggaaagatctcatctacacctgtcgggataacaaagat
tgtctcatcgacaagcgccagcgtaaccgctgccagtactgtcgctaccagaagtgcctg
gtcatgggcatgaagcgggaagctgtgcaagaagaaaggcagaggagccgagagcgagca
gagagcgaggcagagtgtgccagtagtagccacgaagacatgcccgtggagaggattcta
gaagccgaacttgctgtggaaccaaagacagaaccctacggtgacatgaacgtggagaac
tcgacaaatgaccctgttaccaacatatgccatgctgccgataagcaacttttcaccctc
gttgagtgggccaaacgcatcccccacttctcagacctcaccttggaggaccaggtcatt
ctactccgggcagggtggaatgaactgctcattgcctccttctcccaccgctcggtttcc
gtccaggatggcatcctgctggccacgggcctccacgtgcacaggagcagcgctcacagc
gcgggagtcggctccatctttgacagagtccttacagagttggtgtccaagatgaaagac
atgcagatggataagtcagagctggggtgcctacgggccatcgtgctgtttaacccagat
gccaagggtttatccaacccctctgaggtagagactcttcgagagaaggtttatgccact
ctggaggcctataccaagcagaagtatccggaacagccaggcaggtttgccaagcttctt
cttcgtctccctgctctgcgctccatcggcttgaaatgcctggaacacctcttcttcttc
aagctcattggagacactcccattgacagcttcctcatggagatgttggagaccccactg
cagatcacctga

KEGG   Mus caroli (Ryukyu mouse): 110308122
Entry
110308122         CDS       T05910                                 

Gene name
Rxra
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03320  PPAR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04659  Th17 cell differentiation
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04932  Non-alcoholic fatty liver disease
mcal04976  Bile secretion
mcal05160  Hepatitis C
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05216  Thyroid cancer
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110308122 (Rxra)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110308122 (Rxra)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110308122 (Rxra)
   03320 PPAR signaling pathway
    110308122 (Rxra)
   04919 Thyroid hormone signaling pathway
    110308122 (Rxra)
   04928 Parathyroid hormone synthesis, secretion and action
    110308122 (Rxra)
  09154 Digestive system
   04976 Bile secretion
    110308122 (Rxra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308122 (Rxra)
   05202 Transcriptional misregulation in cancer
    110308122 (Rxra)
  09162 Cancer: specific types
   05226 Gastric cancer
    110308122 (Rxra)
   05216 Thyroid cancer
    110308122 (Rxra)
   05222 Small cell lung cancer
    110308122 (Rxra)
   05223 Non-small cell lung cancer
    110308122 (Rxra)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110308122 (Rxra)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110308122 (Rxra)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110308122 (Rxra)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110308122 (Rxra)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110308122 (Rxra)
Nuclear receptors [BR:mcal03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110308122 (Rxra)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 110308122
NCBI-ProteinID: XP_021036145
Ensembl: MGP_CAROLIEiJ_G0023344
UniProt: A0A6P5R2K1
LinkDB
Position
2
AA seq 467 aa
MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAAPSLHPSLGPGIGSPLGSPGQLHSPISTLN
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctctacccaggtgaactcttcatccctc
aactctccaacgggtcgaggctccatggctgccccatcgctgcacccctccttgggtcca
ggaatcggctctccgctgggctcccctgggcagctgcactctcctatcagcaccctgaac
tcccccatcaatggcatgggtccgcccttctctgtcatcagctcccccatgggcccgcac
tccatgtcggtacccaccacacccacattgggcttcgggactggtagcccccagctcaat
tcacccatgaaccccgtgagcagcagtgaggatatcaagccaccactaggcctcaatggc
gtcctcaaggttcctgcccatccctcaggaaatatggcctccttcaccaagcacatctgt
gctatctgtggggaccgctcctcaggcaaacactatggggtatacagttgtgagggctgc
aagggcttcttcaagaggacagtacgcaaagacctgacctacacctgccgagacaacaag
gactgcctgattgacaagagacagcggaaccggtgtcaatactgccgctaccagaagtgc
ctggccatgggcatgaagcgggaagctgtgcaggaggagcggcagcggggcaaggaccgg
aatgagaacgaggtggagtccaccagcagtgccaacgaggacatgcctgtagagaagatt
ctggaagctgagctcgctgtcgagcccaagactgagacatacgtggaggcaaacatgggg
ctgaaccccagctcaccaaatgaccctgttaccaacatctgtcaagcggcagacaagcag
ctcttcactcttgtggagtgggccaagaggatcccacacttttctgagctgcccctggac
gaccaggtcatcctgctacgggcaggctggaacgagctgctgatcgcctccttctcccac
cgctccatagctgtgaaagatgggattctcctggccaccggcctgcacgtacaccggaac
agcgctcacagtgctggggtgggcgccatctttgacagggtgctaacagagctggtgtct
aagatgcgtgacatgcagatggacaagacagagctgggctgcctgcgagccattgtcctg
ttcaatcctgactctaaggggctctcaaaccctgctgaggtagaggcgctgagggagaag
gtgtatgcgtcactagaagcgtactgcaaacacaagtaccccgagcagccgggcaggttt
gccaagctgctgctccgcctgcctgcactgcgttccatcgggctcaagtgcctggagcac
ctgttcttcttcaagctcatcggggacacgcccatcgacaccttccttatggagatgctg
gaggcaccacatcaagccacctag

KEGG   Mus caroli (Ryukyu mouse): 110312146
Entry
110312146         CDS       T05910                                 

Gene name
Rxrb
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03320  PPAR signaling pathway
mcal04659  Th17 cell differentiation
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05216  Thyroid cancer
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110312146 (Rxrb)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110312146 (Rxrb)
   03320 PPAR signaling pathway
    110312146 (Rxrb)
   04919 Thyroid hormone signaling pathway
    110312146 (Rxrb)
   04928 Parathyroid hormone synthesis, secretion and action
    110312146 (Rxrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312146 (Rxrb)
   05202 Transcriptional misregulation in cancer
    110312146 (Rxrb)
  09162 Cancer: specific types
   05226 Gastric cancer
    110312146 (Rxrb)
   05216 Thyroid cancer
    110312146 (Rxrb)
   05222 Small cell lung cancer
    110312146 (Rxrb)
   05223 Non-small cell lung cancer
    110312146 (Rxrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110312146 (Rxrb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110312146 (Rxrb)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    110312146 (Rxrb)
Nuclear receptors [BR:mcal03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   110312146 (Rxrb)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 110312146
NCBI-ProteinID: XP_021041351
Ensembl: MGP_CAROLIEiJ_G0021439
UniProt: A0A6P5REI6
LinkDB
Position
17
AA seq 719 aa
MQHPPPPDTALAFDQQLYGLSGPASLWPTGWGKGLESAVREQQGALTRSGILSVLGLLGR
GTHASSSREIRKLPFLPAPRYLYQHGGAPRGHGVRAHAQSWGLSEGTAGGHRLLRFHLGE
GAGAQGETSRLYKDGGRAGAVTSVPSRARLLSRAATGRGLLASAPPRPPESPAVPPARPW
RLSGSPALGPGVMSWATRPPFLPPRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAA
AAAAAAAGEQQALEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLSQGIRPSSPPGPPLTPS
APPAPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGTPED
VKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLT
YSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEE
MPVDRILEAELAVEQKSDQGVEGPGATGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIP
HFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFD
RSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLETY
CKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgcagcaccccccaccccccgacaccgctctagcctttgatcagcaactttacggtctc
tctgggcccgcgtctctatggcccactggttggggtaaaggcctggaaagcgccgtaagg
gagcagcagggagctctcacccgctccgggatcctctcggttctcggtttgctgggacgt
ggcactcacgcctcgagctcccgcgagatccggaagctccctttcttgcctgcgccccga
tacctttaccaacatggcggcgccccgcgcggccacggcgtcagggcgcatgcgcaaagc
tgggggttatccgaggggacggccggcgggcaccgcctcctccgtttccacctcggcgag
ggggcgggagctcaaggcgagacttcccgtctgtacaaagatggcggccgcgccggtgct
gtcacctcagtgccgagccgagcgcggctcttgagtcgcgctgccacaggccgcggcctg
ctcgcctccgcgcctccgcggcccccggagtcccccgctgtcccccctgcgcgtccctgg
cgcctctccggctcccccgccctcggccccggcgtcatgtcttgggccactcgtccgccc
ttcctcccgccgcggcatgccgcggggcagtgtgggccggtgggggtgagaaaagagatg
cattgtggggtcgcgtcccggtggcggcggcggcggccctggctggatcccgcggcggcg
gcggcggcggcggcggcggccggagagcagcaagccctggagccggagccgggggaggct
ggccgggacgggatgggcgacagcgggcgggattcccgaagcccagacagctcctcccca
aatcccctttcccaggggatccgtccgtcttctcctcctggcccacctcttaccccttca
gcacctccagctccaatgccacccccgccactgggctcccccttcccagtcatcagttct
tccatggggtcccctggtctgccccctccggctcccccaggattctccgggcctgtcagc
agccctcagatcaactccacagtgtcgctccctgggggtgggtctggcacccctgaagat
gtgaagccaccggtcttaggggtccggggcctgcactgtccaccccctccaggtggtcct
ggggctggcaaacggctttgtgcaatctgcggggaccgaagctcaggcaagcactatggg
gtttacagctgcgagggctgcaagggtttcttcaagcgcaccattcggaaggacctgacc
tactcgtgtcgtgataacaaagactgtacagtggacaagcgccagcggaatcgctgtcag
tactgtcgctatcagaagtgcctggccactggcatgaaaagggaggcggttcaggaggag
cgtcaacgggggaaggacaaagacggggatggagacggggctgggggagcccctgaggag
atgcctgtggacaggatcctggaggcagagcttgctgtggagcagaagagtgaccaaggc
gttgaggggcctggggccaccgggggtagtggcagcagcccaaatgacccagtgactaac
atctgccaggcagctgacaaacagctgttcacactcgttgagtgggcaaagaggatccca
cacttctcctccctacctctggacgatcaggtcatactgctgcgggcaggctggaacgag
ctcctcattgcgtccttctcccatcggtccattgatgtccgagatggcatcctcctggcc
acgggtcttcatgtgcacagaaactcagcccattccgcaggcgtgggagccatctttgat
cggtccctctccagggtgctgacagagctagtgtccaaaatgcgtgacatgaggatggac
aagacagagcttggctgcctgcgggcaatcatactgtttaatccagatgccaagggcctc
tccaaccctggagaggtggagatccttcgggagaaggtgtacgcctcactggagacctac
tgcaagcagaagtaccctgagcagcagggccggtttgccaagctgctgttacgtcttcct
gccctccgctccatcggcctcaagtgtctggagcacctgttcttcttcaagctcattggc
gacacccccattgacaccttcctcatggagatgcttgaggctccccaccagctagcctga

DBGET integrated database retrieval system