KEGG   Mus caroli (Ryukyu mouse): 110290735
Entry
110290735         CDS       T05910                                 

Gene name
Notch2
Definition
(RefSeq) neurogenic locus notch homolog protein 2
  KO
K20994  Notch 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04919  Thyroid hormone signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110290735 (Notch2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110290735 (Notch2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110290735 (Notch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290735 (Notch2)
   05206 MicroRNAs in cancer
    110290735 (Notch2)
  09162 Cancer: specific types
   05224 Breast cancer
    110290735 (Notch2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110290735 (Notch2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110290735 (Notch2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 DUF3454 Notch Ank_2 NOD Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Other DBs
NCBI-GeneID: 110290735
NCBI-ProteinID: XP_021013091
Ensembl: MGP_CAROLIEiJ_G0025407
UniProt: A0A6P5PF86
LinkDB
Position
3
AA seq 2471 aa
MLALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGTCVTYHNGTGFCRCPEGFLGE
YCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGT
CHMLSRDTYECTCQIGFTGKQCQWTDACLSHPCENGSTCTSVASQFSCKCPAGLTGQKCE
ADINECDIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCDRNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASF
SCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGVCV
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYMCECP
PGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCSCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
EKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCVQLQNNYKCICRSAFTGRHCETFLDVCPQKPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCAS
NPCQHGGTCYPQRQPPHYSCHCPPPFGGSHCELYTAPTSTPPATCQSQYCADKARDGICD
EACNSHACQWDGGDCSLTMEDPWANCTSTLRCWEYINNQCDEQCNTAECLFDNFECQKNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCASDQPENLAEGTLIIVVLLPPEQLLQ
DSRSFLRALGTLLHTNLRIKQDSQGALMVYPYFGEKSAAMKKQKMTRRSLPEEQEQEVIG
SKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFSELESTRNAQLLY
LLAVAVVIILFFILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEDDPIDRRPWTQQHLEAADIRR
TPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITD
LVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAAD
AQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSAL
HWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDH
MDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGPNRSFLSLKHTPMGK
KARRPNTKSTMPTSLPNLAKEAKDAKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHTYV
SDATSSPMITSPGILQASPTPLLAAAAPAAPVHTQHALSFSNLHDMQPLAPGASTVLPSV
SQLLSHHHIVPPGSSSAGSLGRLHPVPVPADWMNRVEMNETQYNEMFGMVLAPAEGAHPG
IAAPQSRPPEGKHMSTQREPLPPIVTFQLIPKGSIAQAAGAPQTQSSCPPAVAGPLPSMY
QIPEMARLPSVAFPPTMMPQQEGQVAQTILPTYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTHMS
EPPHSNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgctcgctctgcgtcccgccgcgctgcgggcgctgctgtggctctggctgtgcggcgcg
ggccccgcgcacgctttgcagtgtcgaggcggtcaagagccctgtgtaaatgaagggacc
tgtgttacctaccacaacggcacaggcttctgccgatgtccagagggcttcttgggagaa
tattgccaacatcgagacccctgtgagaaaaaccgctgtcagaatggtggtacttgtgtg
ccgcagggcatgttggggaaagccacctgccgatgtgctccagggttcacaggagaggac
tgccaatactccacctctcacccctgctttgtgtcccgcccttgtcagaatgggggtacc
tgtcacatgctcagccgggacacctacgagtgcacctgccagatcggcttcacagggaag
cagtgtcagtggacagatgcctgtctatctcatccctgcgaaaatggaagcacctgtacg
tctgtggccagccagttctcctgcaaatgccctgccggcctcacagggcagaaatgtgaa
gctgatatcaatgagtgtgacattccaggacgctgccaacatggtggcacctgcctcaac
cttcctggttcctacagatgccaatgtccccagggcttcacaggccagcactgtgacagc
ccttatgtgccctgtgcaccctcgccctgcgtcaacggaggcacctgccgtcagactggt
gacttcactttcgaatgcaactgcctgccaggttttgaagggagcacctgtgatcggaat
atcgacgactgccccaaccataagtgtcagaatggaggagtttgtgtggatggtgtcaat
acctacaattgccgctgtccccctcagtggactgggcagttctgcacagaagatgtggac
gagtgtctgttgcagcccaacgcttgtcagaatggaggcacctgcaccaaccgaaacgga
ggctatggctgcgtgtgtgtgaacggctggagcggagatgactgcagcgagaacatcgat
gactgtgcctatgcttcctgcactccagggtccacctgcattgaccgagtggcctccttc
tcctgcctgtgtccggagggaaaggcgggtctcctgtgccatctggatgatgcttgtatc
agcaacccttgtcacaagggggcgctgtgtgacaccaaccccctgaacgggcagtacatt
tgcacctgcccacagggctacaagggcgctgactgcacagaagacgtggatgagtgtgct
atggccaacagtaacccttgtgagcatgcaggaaagtgtgtgaatacagatggcgccttc
cactgtgagtgtttgaagggctacgcagggcctcgctgtgagatggacatcaacgagtgt
cattcagacccctgccagaacgatgccacctgcctggataagatcggaggcttcacctgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgagctggaggtgaatgaatgccagagc
aacccgtgtgtgaacaacgggcagtgtgtggacaaagtcaaccgcttccagtgtctgtgt
ccccctggcttcacaggaccagtgtgccagatcgacattgatgactgctccagtactccc
tgcctgaacggggccaagtgcatcgatcacccaaatggctatgaatgccagtgtgccaca
ggtttcactggcatattgtgtgatgagaacatcgacaactgtgacccagatccttgccac
catggccagtgccaggatgggattgactcctacacctgcatctgcaaccctgggtacatg
ggagccatctgtagtgaccagattgacgaatgctacagcagcccttgcttgaacgatgga
cgctgcattgacctggtgaatggttaccagtgcaactgccaaccaggcacatcaggcctt
aattgtgaaattaattttgatgactgtgccagcaacccttgtatgcacggagtctgtgtg
gacggcatcaatcgttacagttgtgtgtgctctccgggattcacagggcagaggtgcaac
attgacattgatgagtgtgcctccaacccctgtcgcaagggtgcgacgtgcatcaatgat
gtgaatggtttccggtgtatatgccccgagggaccgcatcatcccagctgctactcacag
gtgaacgagtgcctgagcaatccctgcatccacggaaactgtactggaggtctcagtggc
tataagtgcctctgcgatgcaggctgggttggtgtcaactgtgaggtggacaaaaatgag
tgtctttctaacccgtgccagaatggaggaacgtgcaataacctggtgaatggctacagg
tgtacctgcaaaaaggggttcaaaggctacaactgccaggtgaatatagacgagtgtgcc
tccaacccgtgtctgaaccaaggaacctgctttgatgacgtcagtggctacacttgccac
tgcgtgttgccttacacaggaaagaactgccaaacagtgttggctccctgttccccaaac
ccgtgtgagaatgctgctgtttgtaaagaggcacccaattttgagagcttcagctgcttg
tgtgctcctggctggcaaggtaaacgatgtacagttgacgttgatgagtgtatctccaag
ccgtgtatgaacaatggtgtctgccataacactcagggcagctacatgtgtgagtgtcct
cccggcttcagtggtatggactgtgaagaggacatcaatgattgccttgccaacccctgc
cagaatggaggctcctgtgtggaccatgtgaataccttctcctgccagtgccatcctggc
ttcataggggacaagtgccagacagacatgaatgagtgtctgagcgagccctgtaagaat
ggggggacctgctccgactatgtcaacagttacacctgctcatgccccgcgggcttccac
ggagtccactgtgaaaacaacattgacgagtgcactgagagctcctgcttcaatggcggc
acgtgtgttgatggaatcaactctttctcttgcttgtgccccgtgggtttcactggtccc
ttctgcctccatgatatcaatgagtgcagctctaacccgtgcctgaatgcgggaacgtgt
gttgatggtctgggtacctaccgatgcatctgtcccttgggctacaccgggaaaaactgt
cagaccctggtgaacctctgcagccggtctccatgtaaaaacaaaggaacttgtgttcag
gaaaaggcaaggccccactgtctgtgtccgcctggatgggacggtgcatactgtgatgtg
ctcaacgtgtcctgtaaggcggcagccttgcagaaaggagtacctgttgaacacttgtgc
caacactcgggcatctgtatcaatgctggcaacacccatcactgccagtgccccctgggc
tacacggggagctactgcgaggagcagcttgatgagtgtgcatccaatccatgccagcat
ggtgccacctgcaatgacttcatcggaggatacagatgtgagtgtgttccaggatatcag
ggtgtcaactgtgagtatgaagtggacgagtgccagaaccaaccctgccagaatggaggc
acctgcatcgaccttgtgaaccatttcaagtgttcatgtcccccaggcacccggggcctg
ctgtgtgaagagaacattgatgaatgtgctgggggtccccactgccttaatggtggccag
tgtgtggaccggattggaggctacacttgtcgctgtttgcctggctttgctggggagcgg
tgtgagggggacatcaacgaatgcctgtccaacccttgcagctcagagggcagcctggac
tgcgttcaactccaaaataactacaagtgtatctgccgcagcgccttcacgggccggcac
tgtgaaaccttcctagatgtgtgtccccagaagccttgcctgaacggagggacttgtgct
gtggctagcaacatgcccgatggcttcatctgtcgttgtcccccagggttctccggggca
agatgccagagcagctgtggacaagtgaagtgcaggagaggggagcagtgtattcacact
gactcgggacctcgctgcttctgcctgaaccccaaggactgcgagtcaggatgtgccagt
aacccctgccagcacgggggcacctgctatcctcagcgccagcctcctcactattcctgc
cactgccctccgccgttcgggggcagccactgcgaactctacacagcccccaccagcacc
cctcctgctacttgtcagagtcagtactgcgccgacaaggctcgggacggcatctgtgat
gaggcctgcaacagtcatgcctgccaatgggatggaggtgactgttccctcactatggag
gacccctgggccaactgcacctccactcttcgctgctgggaatacatcaacaaccagtgt
gatgagcagtgcaacaccgcagagtgcctgtttgacaactttgagtgccagaagaatagc
aagacgtgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgatcag
ggatgcaacagtgaggagtgtggctgggatgggctggactgcgcttcagaccagcctgag
aacctggcagagggcaccctgatcatcgtggtactcctgccccctgaacagctgctgcag
gattctcgaagcttcttgagggccctgggcaccctgctccacaccaacttgcgcattaaa
caagattctcagggcgctctcatggtgtacccctactttggggagaagtcagctgccatg
aagaagcagaagatgacacgcaggtctcttcctgaggagcaggagcaagaggtgataggc
tctaagatatttctggagatcgacaaccgacagtgtgttcaagattcagaccagtgcttc
aaaaacacagatgcggcagctgctctcctggcttctcatgccatccaagggaccctctcc
taccctctagtgtctgttttcagtgaactggagagtacaagaaacgcccagcttctctat
ctgctcgcggtcgctgttgtcatcatcctgttcttcatcctgctgggggtcatcatggcc
aagcgcaagcgcaagcatggcttcctctggctgccggaagggttcaccctccgccgagac
tctagcaatcacaagcgccgtgaacctgtgggacaggatgccgtagggctgaaaaatctc
tccgtgcaagtgtcggaggctaacctgattggttctgggacaagtgaacattgggttgat
gatgaaggaccccagccaaagaaagccaaggcagaggatgaggctttgctgtcggaagat
gaccccatcgatcgacggccctggacacagcagcaccttgaagctgcagacatccgccgc
actccatctctggcactcactcctcctcaggcagaacaggaggtggacgtgctggacgtg
aatgtccgaggcccagatgggtgtactccactgatgctggcttctctccgaggaggcagc
tcagacctgagtgatgaagatgaagatgctgaggactcttctgccaacatcatcacagac
ttggtttaccaaggtgccagccttcaggcacagacagaccgcactggcgagatggccctg
caccttgcagcccgctattcgagagctgatgctgccaaacgcctcctggacgccggtgca
gatgcaaatgcccaggacaacatgggccgatgtcctcttcatgctgcggttgcagcagac
gcccaaggtgtctttcagattctgatccgcaaccgtgtaaccgatctagatgccagaatg
aacgatggtactacccccctgatcctggctgcccgcctggctgtggaaggaatggtggca
gagttgatcaattgccaagcagatgtcaatgcagtagatgaccatggaaaatctgccctc
cactgggcagctgccgtcaataatgtggaggcgactcttttgctgttgaagaatggggcc
aaccgagatatgcaggacaataaggaagagacacctttgtttcttgctgcccgagaggga
agttatgaagcggccaaaatcctgttagaccattttgccaaccgggacatcactgatcac
atggaccgccttccccgggatgtggctcgggaccgcatgcaccatgacatcgttcgcctc
ctggacgagtataacgtgactcctagccctccggggacggtcttgacttctgctctctca
cctgtcctctgtgggcccaacaggtctttcctcagtctgaagcacaccccaatgggtaag
aaggctaggcggcccaacaccaagagcaccatgcccacgagcctgccaaaccttgccaag
gaggccaaggatgccaagggcagcaggaggaagaagtgtctgaacgagaaggtccagctg
tccgagagctcagtgactctatcccccgtcgattcgctcgagtctcctcacacatatgtc
tctgatgccacatcctctcccatgatcacatcccctggaatcttacaggcctcgcccacc
cctctgctggctgctgccgccccggctgccccagtgcatacacagcatgcactgtctttc
tctaaccttcatgacatgcagcctttggctcctggagccagcaccgtgcttccctcagtc
agccagctgctatcccaccaccacatcgttcccccaggtagtagcagtgcaggaagcttg
ggcaggttacatccagttcctgtcccagcagactggatgaaccgtgtggagatgaatgag
acccagtacaatgaaatgtttggcatggtcctggctcccgcagagggagcccaccctggc
atagcagctccccagagcagacctccggaagggaagcacatgtccacccagcgggagccc
ttgcctcccatcgtgactttccagcttatcccaaaaggcagcattgcccaggcagccgga
gctccccagacgcaatccagttgccctccagctgttgcaggccccttgccctctatgtac
cagatcccagagatggcccgtttgcccagtgtggctttcccacctaccatgatgccccag
caggaggggcaggtagctcagaccattttgccaacctatcatcctttcccagcctctgtg
ggcaagtaccccacacctccttcccaacacagttacgcctcctcaaatgctgctgagcga
acccccagtcatggtggtcacctccagggtgagcacccatacctgacaccatccccagag
tctcctgaccaatggtcaagctcttcaccacactctgcatctgactggtcagatgtgacc
accagcccaactcctggaggtggtggaggcggtcagcggggacccggaacacacatgtcc
gagccaccacacagcaacatgcaggtttatgcatga

KEGG   Mus caroli (Ryukyu mouse): 110308685
Entry
110308685         CDS       T05910                                 

Gene name
Notch1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04919  Thyroid hormone signaling pathway
mcal05020  Prion disease
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110308685 (Notch1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110308685 (Notch1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110308685 (Notch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308685 (Notch1)
   05206 MicroRNAs in cancer
    110308685 (Notch1)
  09162 Cancer: specific types
   05224 Breast cancer
    110308685 (Notch1)
  09164 Neurodegenerative disease
   05020 Prion disease
    110308685 (Notch1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110308685 (Notch1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110308685 (Notch1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 NOD Notch Ank DUF3454 NODP Ank_5 Ank_4 Ank_3 EGF_3 cEGF
Other DBs
NCBI-GeneID: 110308685
NCBI-ProteinID: XP_021036757
Ensembl: MGP_CAROLIEiJ_G0023318
UniProt: A0A6P5QY40
LinkDB
Position
2
AA seq 2531 aa
MPRLLTPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDS
NPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGHCMDKINEFLCQCPKGFNGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGICKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID
GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYT
GRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANC
TDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
DVNECDSRPCLHGGTCQDSYGTYKCTCSQGYTGLNCQNLVHWCDSAPCKNGGRCWQTNTQ
YHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGS
YCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG
PECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQVDAGNKVCNMQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVKSEPVEPPLPSQLHLMYVAAAAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQ
NEWGDEDLETKKFRFEEPVVLPDLSDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGS
KEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMP
LSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNG
TGAMNFTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHSMMGPL
HSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQIQPQNLQPPSQPHLSVSSAA
NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMAPPMTTTQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTTMP
SQITHIPEAFK
NT seq 7596 nt   +upstreamnt  +downstreamnt
atgccacggctcctgacgcccttgctctgcctaacgctgctgcccgcgctcgccgcaaga
ggcttgagatgctcccagccaagtgggacctgcctgaatggagggaggtgcgaagtggcc
aacggcactgaagcctgtgtctgcagcggagcctttgtgggccaacgatgccaggactcc
aatccttgcctcagcacaccgtgtaagaatgctggaacgtgccacgttgtggaccatggt
ggcactgtggattatgcctgcagctgtcccctgggtttctctgggcccctctgcctgaca
cctctggacaacgcctgcctggccaacccctgccgcaatgggggcacctgtgacctgctc
actctcacagagtacaagtgccgctgcccaccagggtggtcaggaaaatcatgtcagcag
gccgacccctgtgcctccaacccctgtgccaatggtggccagtgcctgccctttgagtct
tcatacatctgtcgctgcccgcctggcttccatggccccacctgcaggcaagatgttaat
gagtgcagccagaaccctgggctgtgccgccatggaggcacctgccacaatgagatcggc
tcctatcgctgtgcctgccgtgccacccatactggtccccactgtgaactgccctacgtg
ccctgcagcccctcaccctgccagaatggaggcacctgccgccctacaggggacaccacc
cacgagtgtgcctgcttgccaggttttgctggacagaactgtgaagaaaatgtggatgac
tgtccaggaaacaactgcaagaatggaggtgcctgtgtggacggcgtgaatacctacaat
tgccgctgcccaccggagtggacaggtcagtactgtacagaggatgtggacgaatgtcag
ctcatgcccaatgcctgccagaatggcggaacctgccacaacacacacggtggctacaac
tgtgtgtgtgtcaatgggtggactggcgaggactgcagcgagaacattgatgactgtgcc
agtgccgcctgtttccagggtgccacttgccatgaccgtgtggcttccttctactgcgaa
tgtccacatgggcgcacaggtctgctgtgccacctcaacgatgcgtgcatcagcaacccc
tgcaacgagggctccaactgtgacaccaaccctgtcaacggcaaagccatctgcacctgc
ccctcggggtacacagggccagcctgcagccaggacgtggatgagtgtgctctgggtgcc
aacccttgtgagcacgcaggcaagtgcctcaacacactgggttcttttgagtgccagtgt
ctacagggctacacaggaccccgctgtgagattgatgttaatgagtgcatctccaacccg
tgtcagaatgatgccacttgcctggaccagattggggagttccaatgcatatgtatgcca
ggttatgaaggtgtatactgtgaaatcaacacggatgagtgcgccagcagcccctgtctg
cacaatggccactgcatggacaagatcaatgagttcctatgtcagtgccccaaaggcttc
aacgggcacctgtgccagtatgatgtggatgagtgtgccagcacaccatgcaagaatggc
gccaagtgcctggatgggcccaacacctatacctgcgtgtgtacagaaggttacacgggg
acccactgcgaagtggacattgacgagtgtgaccctgacccctgtcactatggtatctgt
aaggatggtgtggccacctttacctgcctgtgccagccaggctacacaggccatcactgt
gagaccaacatcaatgagtgccacagccaaccgtgccgccatgggggcacctgccaggac
cgtgacaactcctacctctgcttatgcctcaagggaaccacagggcccaactgtgagatc
aacctagatgactgcgccagcaacccctgtgactctggcacctgtctggacaagattgat
ggctacgaatgtgcctgcgaaccaggctacacaggaagcatgtgtaacgtcaacattgac
gaatgtgcgggcagcccctgccacaacgggggcacttgtgaggatggcatcgcgggcttc
acttgccgctgccccgagggctaccatgaccccacgtgcctgtccgaggtcaacgagtgc
aacagtaacccctgcatccacggagcttgccgggatggcctcaatgggtacaagtgtgac
tgtgcccctgggtggagtggaacaaactgtgacatcaacaacaacgagtgtgagtccaac
ccttgtgtcaacggtggcacctgcaaggacatgaccagtggctacgtatgcacctgccga
gaaggcttcagtggccctaattgccagaccaacatcaacgaatgtgcctccaacccctgc
ctgaaccaggggacctgcattgatgatgtcgctggatacaagtgcaactgtcctctgccg
tatacaggagccacgtgtgaggtggtgttggccccatgtgctaccagcccctgcaaaaac
agcggggtatgcaaggagtctgaagactacgagagtttttcctgtgtctgtcccacaggc
tggcaaggtcaaacctgcgaggttgacatcaacgagtgtgtgaaaagcccatgtcgccat
ggagcctcctgccagaacaccaatggcagctaccgctgcctctgccaggccggctataca
ggtcgcaactgtgagagtgacatcgatgattgccgccccaacccgtgtcacaatgggggt
tcctgcaccgatggcatcaacacagccttctgcgactgcctgcccggcttccagggtgcc
ttctgtgaggaggacatcaacgaatgtgccagcaatccctgccaaaatggtgccaattgc
actgactgtgtggacagttacacgtgtacctgccccgtgggcttcaacggcatccactgc
gagaacaacacacctgactgtactgagagctcctgcttcaatggtggtacctgtgtggat
ggtatcaactccttcacctgtctgtgtccacctggcttcacgggcagctactgccagtat
gatgtcaatgagtgtgattcacggccctgtctgcacggtggcacctgccaagacagctat
ggtacctataagtgtacctgctcacagggctacactggtctcaactgccagaaccttgtg
cactggtgcgactcggctccctgcaagaatggtggcaggtgctggcagaccaacacgcag
taccactgtgagtgccgcagcggctggactggcgtcaactgcgacgtgctcagtgtgtcc
tgtgaggtggctgcacagaagcgaggcattgacgtcactctcctgtgccagcatggaggg
ctctgtgtggatgagggagataaacattactgccactgccaggcaggctacacgggcagc
tactgtgaggacgaggtggacgagtgctcacctaacccctgccagaacggggctacctgc
actgactatctcggtggcttttcctgcaagtgtgtggctggctaccatgggtctaactgc
tccgaggagatcaacgagtgcctgtcccagccctgccagaatgggggtacctgcattgat
ctgaccaactcctacaagtgttcctgcccccgggggacacagggtgtacactgtgagatc
aatgttgatgactgccatcccccccttgaccctgcctcccgaagccccaagtgcttcaac
aatggcacctgtgtggaccaggtgggtggctatacctgcacctgcccaccaggcttcgtc
ggggagcggtgtgagggtgatgtcaatgagtgtctctccaacccctgtgacccacgtggc
acccagaactgtgtgcagcgtgttaatgacttccactgcgagtgccgggctggccacact
ggacgccgctgtgagtcagtcatcaatggctgcaggggcaaaccgtgcaagaatgggggt
gtctgtgccgtggcctctaacaccgcccgtggattcatctgtaggtgccctgcgggcttc
gagggtgccacatgtgagaatgatgcccgcacttgtggcagcttgcgctgcctcaacggt
ggtacatgcatctcgggcccacgtagtcccacctgcctctgcctgggatccttcaccggc
cctgagtgccagttcccagccagcagcccctgtgtgggtagcaacccctgctacaatcag
ggcacctgtgagcccacatctgagaaccctttctaccgctgtctatgccctgccaaattc
aacgggctactgtgccacatcctggactacagcttcacaggtggcgctgggcgcgacatt
cccccaccacagattgaggaggcctgtgagctgcctgagtgccaggtggatgcaggcaat
aaggtctgcaacatgcagtgtaataatcacgcatgtggctgggatggcggtgactgctcc
ctcaacttcaatgacccttggaagaactgcacgcagtccctacagtgctggaagtatttt
agtgacggccactgtgacagccagtgcaactcggccggctgcctctttgatggcttcgac
tgccagctcaccgagggacagtgcaaccccctgtatgaccagtactgcaaggaccacttc
agtgatggccactgcgaccagggctgtaacagtgccgaatgtgagtgggatggcctagac
tgtgctgagcacgtacccgagcggctggcagccggcaccctggtgctggtggtgctgctt
ccacccgaccagctacggaacaactccttccacttcctgcgggagctcagccacgtgctg
cacaccaacgtggtcttcaagcgtgatgcgcaaggccagcagatgatcttcccgtactat
ggccacgaggaagagctgcgcaagcacccaatcaagcgctctacagtgggttgggccacc
tcttcactgcttcctggtaccagtggtgggcgccagcgcagggagctggaccccatggac
atccgtggctccattgtctacctggagatcgacaaccggcaatgtgtgcagtcatcctcg
cagtgcttccagagtgccaccgatgtggctgccttcctaggtgctcttgcatcacttggc
agcctcaatattccttacaagattgaggccgtaaaaagtgagccggtggagcctccgctg
ccctcgcagctgcacctcatgtacgtggcagcggccgccttcgtgctcctgttctttgtg
ggctgtggggtgctgctgtcccgcaagcgccggcggcagcatggccagctctggttccct
gagggtttcaaagtgtcagaggccagcaagaagaagcggagagagcccctcggcgaggac
tcagtcggcctcaagcccctgaagaatgcctcagatggtgctctgatggacgacaatcag
aacgagtggggagacgaagacctggagaccaagaagttccggtttgaggagccagtagtt
ctccctgacctgagtgaccagactgaccacaggcagtggacccagcagcacctggacgct
gctgacctgcgcatgtctgccatggccccaacaccgcctcagggggaggtggatgctgac
tgcatggatgtcaatgttcgaggaccagatggcttcacacccctcatgattgcctcctgc
agtggagggggccttgagacaggcaacagtgaagaagaagaagatgcacctgctgtcatc
tctgacttcatctaccagggcgccagcttgcacaaccagacagaccgcaccggggagacc
gccttgcacttggctgcccgatactctcgttcagatgctgcaaagcgcttgctggaggcc
agtgcagatgccaacatccaggacaacatgggccgtactccgttacatgcagcagtttct
gcagatgctcagggtgtcttccagatcctgctccggaacagagccacagatctggatgcc
cgaatgcatgatgggacaactccactgatcctggctgcgcgcctggccgtggagggcatg
ctagaggacctcatcaactcacatgctgatgtcaatgccgtggatgacctaggcaagtcg
gctttgcattgggcagccgctgtgaacaatgtggatgctgctgttgtgctcctgaagaac
ggagccaacaaagacatgcagaacaacaaggaggagacccccctgttcctggccgcccgt
gagggcagctatgagactgccaaagtgttgctggaccactttgccaaccgggacatcacg
gatcacatggaccgattgccgcgggacatcgcacaggagcgtatgcaccatgatatcgtg
cggcttttggatgagtacaacctggtgcgcagcccacagctgcatggcactgccctgggt
ggcacacccactctgtctcccacactctgctcgcccaatggctacctgggcaatctcaag
tctgccacacagggcaagaaggcccgcaagcccagcaccaaagggctggcttgtggtagc
aaggaagctaaggacctcaaggcacggaggaagaagtcccaggatggcaagggctgcctg
ttggacagctcgagcatgctgtcgcctgtggactccctcgagtcaccccatggctacttg
tcagatgtggcctcgccacccctcctcccctccccattccagcagtctccatccatgcct
ctcagccacctgcctggtatgcctgacacccacctgggcatcagccacttgaatgtggca
gccaagcctgagatggcagcactggctggaggtagccggttggcctttgagccacccccg
ccacgcctctcccacctgcctgtagcctccagtgccagcacagtgctgagtaccaatggc
acgggggctatgaatttcactgtgggtgcaccggcaagcttgaatggccagtgtgagtgg
cttccccggctccagaatggcatggtgcccagccagtacaacccactacggccgggtgtg
acgccgggcacactgagcacacaggcagctggcctccagcatagcatgatggggccacta
cacagcagcctctccaccaataccttgtccccgattatttaccagggcctgcccaacaca
cggctggccacacagccccacctggtgcagacccagcaggtgcagccacagaacttacag
atccagcctcagaacctgcagccaccatcgcagccacacctcagtgtgagctcggcagcc
aatgggcacctgggccggagcttcttgagtggggagcccagccaggcagatgtacaaccg
ctgggccccagcagtctgcctgtgcacaccattctgccccaggaaagccaggccctgccc
acatcactgccatcctccatggccccacccatgaccactacccagttcctgacccctcct
tcccagcacagctactcctcctcccctgtggacaacacccccagccaccagctgcaggtg
ccagagcaccccttcctcaccccatcccctgagtcccctgaccagtggtccagctcctcc
ccgcattccaacatctctgattggtccgagggcatctccagcccgcccaccaccatgccg
tcccagatcacccacattccagaggcatttaaataa

KEGG   Mus caroli (Ryukyu mouse): 110312347
Entry
110312347         CDS       T05910                                 

Gene name
Notch4
Definition
(RefSeq) neurogenic locus notch homolog protein 4 isoform X1
  KO
K20996  Notch 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110312347 (Notch4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110312347 (Notch4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312347 (Notch4)
   05206 MicroRNAs in cancer
    110312347 (Notch4)
  09162 Cancer: specific types
   05224 Breast cancer
    110312347 (Notch4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110312347 (Notch4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110312347 (Notch4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_5 Ank Ank_2 Notch Ank_3 Ank_4 EGF_2 NODP EGF_3 NOD FXa_inhibition EGF_MSP1_1 cEGF
Other DBs
NCBI-GeneID: 110312347
NCBI-ProteinID: XP_021041515
Ensembl: MGP_CAROLIEiJ_G0021461
UniProt: A0A6P5R2K8
LinkDB
Position
17
AA seq 1965 aa
MQPQLLLLLLLLPLSFPVILTRELLCGGSPEPCANGGTCLRLSRGQGICQCAPGFLGETC
QFPDPCRDTQLCKNGGSCQALLPTPPGFRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELC
PPSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRC
SPGFEGHTCEHDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACRPGS
CLNGGTCQLVPEGDFTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLC
PKTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGGFHCVCVSGWGGIGCEENLDDCAAA
TCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQP
GYSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQ
PCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPG
FTGARCEKDMDECSSTPCANGGRCRDQPGAFHCECLPGFEGPHCETEVDECLSDPCPVGA
SCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAE
DNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYL
GLTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTC
VNKPGTFFCLCATGFQGPHCEEKTNPSCADSPCRNKATCQDTPGGARCLCSPGYTGSGCQ
TLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDLPVSCQKAAMSQGIEISGLCQN
GGLCIDTGSSYFCRCPPGFQGKLCQDNVNPCETNPCHHGATCVPQPSGYVCQCAPGYEGQ
NCSKVLDACQSQPCHNHGTCTPRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAAC
HSLANAFYCQCLPGHTGQRCEVEMDLCQSQPCFNGGSCEITTGPPPGFTCHCPKGFEGPT
CSHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHN
GSCTEIPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDC
SLGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPPTCIPAYDQYCRDHF
HNGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTL
RVGLWVRKDSEGRNMVFPYPGTRAKEELSGAKDSSSWERQAPPTQPLGKETESLGAGFVV
VMGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRPPAN
QLPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPP
LGEDNIGLKTLKPEAEVDEDGVAMCSGPEEGEAEETASASRCQLWPLNSGCGELPQAAML
TPPQECESEALDVDTCGPDGVTPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGA
CPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQ
LLLASRQTTVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAV
NNARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGLAPG
DVARQRSHWDLLTLLEGVGPTTQEARAHARTTPGGGAAPRCRTLSAGARPRGGGACLQAR
TWSVDMGARGGTVHARCRSRSGSCGGPTTRGRRFSAGSRGRRGARASQDDWPRDWVALEA
CGSACSAPIPPPSLTPSPERGSPQVAWGLPVHQEIPLNSVGRNLN
NT seq 5898 nt   +upstreamnt  +downstreamnt
atgcagccccagttgctgctgctgctgctgctcttgccactcagtttccctgtcatcctg
accagagagcttctgtgtggaggatccccagagccctgtgccaacggaggcacttgcctg
aggctgtctcggggacaagggatctgccagtgtgcccctggatttctgggtgagacttgc
cagtttcctgacccctgcagggatacccaactctgcaagaatggtggcagctgccaagcc
ctgctccccacacccccaggcttccgtagtcctacttctccactgacccctcacttctcc
tgcacctgcccctctggcttcactggtgatcgatgccaaacccatctggaagagctctgt
ccaccttctttctgttccaacggaggtcactgctatgttcaggcctcaggccgcccacag
tgctcctgcgagcctgggtggacaggtgagcaatgccagctccgagacttctgctcagcc
aacccctgtgccaatggaggcgtgtgcctggccacatacccccagatccagtgccgctgt
tcacctgggttcgagggtcacacctgtgaacacgacatcaacgagtgcttcctggagccg
ggaccctgccctcagggcacctcctgtcataacaccttgggttcctaccagtgtctctgc
cctgtggggcaggaaggtccccagtgcaagctcaggaagggagcctgccgacctggaagc
tgtctcaatgggggcacctgccagctggtcccagagggagacttcacctttcatctctgc
ctctgtcccccaggtttcacggggctggactgtgagatgaacccagatgactgtgtcagg
caccagtgtcagaacggggccacctgtctggatgggctggacacctacacctgcctctgc
cccaagacatggaagggctgggactgctctgaagatatagatgaatgtgaagcccggggt
ccccctcgctgcagaaacggtggcacctgccagaacacagctggcggctttcactgtgtg
tgcgtgagtggctggggaggcataggctgtgaggagaacctggatgactgtgcggccgcc
acctgtgccccaggatccacctgcatcgaccgtgtgggctccttctcctgcctctgccca
cctggacgcacaggcctcctgtgccacctggaagacatgtgtttgagccagccgtgccat
gtgaatgcccagtgcagcaccaaccctctgacaggctccaccctctgcatatgccagcct
ggctactcaggatccacctgtcaccaagatctggatgagtgccaaatggcccagcaagga
cccagtccctgtgaacatggcggctcctgcatcaacacccctggctccttcaactgcctc
tgcctgcctggttacacgggctcccgctgtgaagctgaccacaatgagtgcctgtcacag
ccctgccacccgggcagcacctgcctggacctgcttgcaaccttccactgcctctgccca
ccaggcttggaagggaggctctgtgaggtggaggtcaatgagtgcacctctaacccctgc
ctgaaccaagctgcctgccatgacctgctcaacggcttccagtgcctctgccttcctgga
ttcaccggcgccagatgtgagaaagacatggacgagtgtagcagcaccccctgtgccaat
ggggggcgctgccgagaccagcctggagccttccactgcgagtgtctcccaggctttgaa
gggccacactgcgagacagaagtggacgaatgtcttagtgatccctgccccgtgggagcc
agctgccttgatcttcccggagcattcttctgcctctgccgtcccggtttcacaggtcaa
ctttgtgaggttcccttgtgcacccccaacatgtgccaacctggacagcaatgccaaggt
caggaacacagagccccctgcctctgccctgacggaagtcctggctgtgttcctgctgag
gacaactgcccctgtcaccatggccattgccagagatccttgtgtgtgtgtgacgagggc
tggactggaccagaatgtgagacagaactgggtggctgcatctccacaccctgtgcccat
ggggggacctgccacccacagccgtctggctacaactgtacctgccctgcaggctacctg
gggttgacctgtagtgaggaggtgacagcttgtcactcagggccctgtctcaatggtggc
tcctgcagcatccgtcctgagggctattcctgcacctgccttccaagtcacacaggtcgc
cactgccagactgccgtggaccactgtgtgtctgcctcgtgcctcaatgggggtacctgt
gtgaacaagcctggcactttcttctgcctctgtgccactggcttccaggggccgcactgt
gaggagaagactaaccccagctgtgcagacagcccctgcaggaacaaggcaacctgccaa
gacacacctggaggggcccgctgcctctgcagccctggctatacaggaagcggctgccag
actctgatagacttgtgtgcccggaagccctgtccacacactgcccgatgcctccagagt
gggccctccttccagtgcctgtgcctccagggatggacaggggctctctgtgacctccca
gtgtcctgccagaaggccgcgatgagccaaggcatagagatctctggcctgtgccagaat
ggaggcctctgtattgacacgggctcctcctatttctgccgctgccctcctggatttcaa
ggcaagttatgccaggataatgtgaacccctgtgagactaatccttgccatcacggggct
acctgtgtgccccagcccagtggctatgtctgccagtgtgccccaggctatgagggacag
aactgctcaaaagtacttgacgcttgtcagtcccagccctgccacaaccacggaacctgt
acccccaggcctggaggcttccactgtgcctgccctccaggctttgtgggactgcgttgt
gagggagatgtggatgagtgtctagaccggccctgtcacccttcgggcactgcagcttgc
cactctttagccaacgccttctactgccagtgtctgcctgggcacacaggccagcgatgt
gaggtggagatggacctctgtcagagccagccctgcttcaatggagggtcctgtgagatc
acaacagggccaccccctggcttcacctgccactgccccaagggttttgaaggccccacc
tgcagccacaaagccctttcctgcggcatccatcactgccacaatggaggcctatgcctg
ccctcccctaagccagggtcaccaccactctgtgcctgcctcagtggttttgggggccct
gactgtctgacacctccagctccaccgggctgcggtcccccctcaccctgcctgcacaat
ggtagctgcactgagatccctgggttgggcaacccgggctttcaatgcacctgccctcct
gactctccagggccccggtgtcaaaggccaggggcaagtggatgtgagggccgaggtggt
gatgggacctgcgatgctggctgcagtggcccaggaggagactgggatggaggggactgt
tccctgggggtcccagacccctggaagggctgtcccccgcattcccagtgctggcttctc
ttccgggatgggcggtgtcacccgcagtgtgactctgaggagtgtctgtttgatggctac
gactgtgaaatccctccaacctgcatcccagcctatgaccagtactgccgagatcacttc
cacaatgggcactgtgagaaaggctgcaataatgctgagtgtggctgggacggaggagac
tgcagaccagaaggggaggattcagaggggaggccctccctggccctgctggtggtgctg
aggcccccagccctggatcagcagctgcttgccctggcacgagtgctgtccctgactctg
agggttggtctctgggtgaggaaagacagtgaaggcaggaacatggtgttcccctatcct
gggacccgggccaaagaggagctgagtggagctaaggattcctcttcgtgggaaagacaa
gcccctcccactcagcccctgggcaaggagacggagtctcttggtgcagggtttgtggta
gtgatgggagtggatctgtcccgctgtggtccggaacatcctgcgtcccgctgtccctgg
gactctggactcctgctgcgcttccttgcagcaatggctgcagtgggagctctggagccc
ctgctgcctggacccttgctggcggctcaccctcaagcagggaccaggccccctgccaac
cagcttccctggcccattctatgttcaccagtggttggggtgcttctcctggcccttggg
gcccttctcgtcctccagctcattcggcgccggcggcgagaacatggggccctgtggctg
ccccctggtttcattcgaaggcctcagacacagcaggcaccccaccggcggaggccccca
ctgggcgaggacaacattggtcttaagacactgaagccagaggccgaagtggatgaggat
ggagtggccatgtgctcgggccctgaagagggagaggctgaagaaacagcctcagcctcc
aggtgccagctttggccgctcaacagcggctgtggagagctcccccaggcagccatgctg
acccctcctcaggagtgtgaatcggaggctctagacgtggacacctgtggacctgatggg
gtgacacccctgatgtcagccgtcttctgtgggggagtgcagtccacaactggggctagt
ccacagagactggggctaggaaatctggaaccctgggaaccactgctggatagaggggcc
tgcccccaggctcacactgtgggcactggagagacacctctgcacctagctgccagattc
tctcggccaaccgctgcccgccgcctccttgaggctggagccaaccccaaccagccagac
cgcgctgggcgcaccccacttcacactgctgtggctgctgacgctcgggaggtttgccag
ctcctattggccagcagacagactacggtggacgcccgcacagaggacgggactacacct
ttgatgctggctgccaggctggccgtggaggacctggttgaagaattgatcgcagcccga
gcagatgtaggagccagggataaaaggggaaaaactgcactgcactgggccgctgctgtg
aacaacgcccgagccgcccgctctctcctccaggctggagcggataaagatgcccaggac
agtagggagcagacgcctcttttcctggcagcgcgcgaaggcgccgtggaggtggcgcag
ctgctgctggagctcggggcggcccggggactgcgagaccaggccgggctggccccagga
gatgtggcccgccagcgcagtcactgggacctgctaacgttgctggaaggggtcggaccg
accacgcaagaggcccgtgcgcacgcacgcaccacgccggggggcggggccgcgccgcgc
tgccggacgctgtctgcgggagcgcgcccgcgcgggggcggagcctgtctgcaggctcgc
acttggtcggtggacatgggagcgcgcggagggacggtgcatgcgcgctgccggagccga
tctggaagctgcggaggccccaccacgcgcggccgcaggttctccgcgggctcccgtgga
cgacgcggggctagggcatcacaggatgactggcctcgcgactgggtggccctggaagcc
tgcggctccgcctgcagtgcgccgatcccgcctcccagcctgaccccgtccccagaacgt
ggatcccctcaagttgcctggggtcttccagtccaccaagagattcccttaaactcggtt
ggacgaaatctgaactag

KEGG   Mus caroli (Ryukyu mouse): 110312607
Entry
110312607         CDS       T05910                                 

Gene name
Notch3
Definition
(RefSeq) neurogenic locus notch homolog protein 3
  KO
K20995  Notch 3
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04330  Notch signaling pathway
mcal04371  Apelin signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04919  Thyroid hormone signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05206  MicroRNAs in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110312607 (Notch3)
   04371 Apelin signaling pathway
    110312607 (Notch3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110312607 (Notch3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110312607 (Notch3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110312607 (Notch3)
   05206 MicroRNAs in cancer
    110312607 (Notch3)
  09162 Cancer: specific types
   05224 Breast cancer
    110312607 (Notch3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110312607 (Notch3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110312607 (Notch3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch Ank EGF_2 Ank_5 NODP NOD DUF3454 Ank_4 Ank_3 cEGF EGF_3
Other DBs
NCBI-GeneID: 110312607
NCBI-ProteinID: XP_021041998
Ensembl: MGP_CAROLIEiJ_G0021377
UniProt: A0A6P5RAA0
LinkDB
Position
17
AA seq 2320 aa
MGLGARGRRRRRRLMALPPPPPPMRALPLLLLLAGLGAAAPPCLDGSPCANGGRCTHQQP
SLEAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQ
PDPCISRPCAHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPG
SFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDD
CPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHS
CVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP
CHEDAICDTNPVSGRAICTCPPGFTGGACDQDVNECSIGANPCEHLGRCVNTQGSFLCQC
GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCV
NGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLD
LVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCV
CEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSL
CEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECASASPCGPHGTCTNLPGNFRCICHR
GYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCPDGFAGPRCARDVDECLSSPCGPG
TCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGTHC
QYEADPCFSRPCLHGGICNPTHPGFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCVQTG
AYCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGQCIDKGRSHYCVCPEGRTGS
HCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCID
LVARYLCSCPPGTLGVLCEINEDDCDPGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTG
LHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCESQPCQHGG
QCRHSLGRGGGLTFTCHCVQPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPGL
SGPSCRVSRASPSGATNATSCASAPCLHGGSCLPVQSVPFFRCVCALGWGGPRCETPSAA
APEVPEEPRCPRAACQAKRGDQNCDRECNSPGCGWDGGDCSLNVDDPWRQCEALQCWRLF
NNSRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADHFADGRCDQGCNTEECGWDG
LDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFP
YHRPSPGSESRVRRELGPEVIGSVVMLEIDNRLCLQSAENDHCFPDAQSAADYLGALSAV
ERLDFPYPLRDVRGEPLEAPEQSVPLLPLLVAGAVFLLIIFILGVMVARRKREHSTLWFP
EGFALHKDIAAGHKGRREPVGQDALGMKNMAKGESLMGEVVTDLNDSECPEAKRLKVEEP
GMGAEEPEDCRQWTQHHLVAADIRVAPATALTPPQGDADADGVDVNVRGPDGFTPLMLAS
FCGGALEPMPAEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKR
LLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLA
VEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLF
LAAREGSYEAAKLLLDHLANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPSGPH
GLGPLLCPPGAFLPGLKAVQSGTKKSRRPPGKTGLGPQGTRGRGKKLTLACPGPLADSSV
TLSPVDSLDSPRPFSGPPASPGGFPLEGPYATTATAVSLAQLGASRAGPLGRQPPGGCVL
SFGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAAPGHG
EEYPAVGTRSSPTKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATS
ATASGALPAQPHPISVPSLPQSQTQLGPQPEVTPKRQVMA
NT seq 6963 nt   +upstreamnt  +downstreamnt
atggggctgggggcccggggccgccgccgccgtcgtcgcctgatggccctgccaccgcca
ccaccgcccatgcgggcgctgcccctgctgctgctgctagcggggctgggggctgcagca
cccccttgtctggatggaagcccatgtgcaaatggaggtcggtgcacccaccagcagccc
tccctggaggctgcttgcctgtgcctgccaggctgggtgggtgagcggtgccagctggaa
gacccttgccactcaggcccctgtgctggccgaggcgtttgccagagttcagtggtggcg
ggcaccgcccggttctcctgtcgttgtctccgtggcttccaaggcccagactgctcccag
ccagacccctgcatcagcaggccctgtgctcatggtgccccctgctcagtggggccggat
ggccgatttgcctgtgcctgcccacctggctaccagggtcaaagctgccaaagtgacata
gatgagtgccgatctggtacgacttgccgccatggtggtacctgcctcaatacacctgga
tccttccgctgccagtgtcctcttggttatacagggctgctgtgtgagaaccctgtagtg
ccctgtgccccttccccgtgtcgtaatggtggcacctgtaggcagagcagtgatgtcaca
tatgactgtgcttgccttcctggcttcgagggccagaactgtgaagtcaacgtggatgac
tgtcctggacatcggtgtctcaatgggggaacatgtgtagatggtgtcaatacttacaac
tgccagtgccctccggagtggacaggccagttctgtacagaagatgtggatgagtgtcag
ctgcagcccaatgcctgccacaacgggggtacctgcttcaacctactgggtggccacagc
tgtgtatgtgtcaatggctggacgggtgagagctgcagtcagaatatcgatgactgtgct
acagctgtgtgtttccatggggccacctgccatgaccgtgtggcctctttctactgtgcc
tgccctatggggaagacaggcctcttgtgtcatctggatgatgcatgtgtcagcaacccc
tgccatgaggatgctatctgtgacacaaaccctgtgagtggccgggccatctgcacctgc
ccacctggcttcactggaggagcatgtgaccaggatgtgaatgagtgctccattggtgcc
aacccctgtgaacatttgggtcggtgtgtgaatacacagggctcattcttgtgccaatgt
ggccgtggctatactggacctcgctgtgagactgatgtcaatgagtgtctctctgggcct
tgccgcaaccaggctacatgtcttgatcgaattggccagtttacttgcatctgcatggca
ggcttcacagggacctactgtgaggtggacatcgacgaatgccagagcagtccatgtgtc
aatggtggtgtctgcaaggacagagtcaatggcttcagctgcacctgcccatcaggattc
agtgggtccatgtgtcagctggatgtagatgagtgtgcaagcactccctgccggaatggt
gccaagtgtgtggaccagcctgacggctatgagtgtcgctgtgcagagggctttgagggc
actttgtgtgagagaaacgtggatgactgctctccggatccctgccaccacgggcgctgt
gtcgatggcattgctagcttctcgtgtgcttgtgccccaggctatacgggcatacgctgt
gagagccaggtggatgagtgccgcagccagccctgccgatatgggggcaaatgtctagac
ttggtggacaagtacctctgccgctgtcctcccggaaccacaggtgtgaactgtgaagtc
aacattgatgactgtgccagtaacccctgtacctttggagtttgccgcgatggcatcaac
cgttatgactgtgtctgtcagcctggattcacagggcccctctgcaacgtggagatcaat
gagtgtgcatccagcccatgtggagagggtggctcctgtgtggatggggaaaatggcttc
cactgcctctgtccacctggctccctgcctccactttgcctacctgcgaaccatccctgt
gcccacaagccctgtagtcatggagtctgccatgatgcaccaggcgggttccgctgtgtt
tgtgagcccgggtggagtggccctcgctgtagccagagcctggctccagatgcctgtgag
tcccagccctgccaggctggtggcacctgcaccagtgatggaataggctttcgctgcacc
tgtgcccctggattccagggccatcagtgtgaggtgctgtccccctgcactccaagcctc
tgtgagcacggaggccactgtgagtctgaccctgaccggctgactgtctgttcctgtccc
ccaggctggcaaggcccacgatgccagcaggatgtggatgagtgtgccagcgcctcaccc
tgcggcccccatggtacctgcaccaacctgccagggaatttcaggtgcatctgccacagg
ggatacactggccccttctgtgatcaagacattgacgactgtgaccccaacccgtgcctc
catggtggctcctgccaggatggtgtgggctccttttcctgttcttgccccgacggcttt
gctggtcctcgctgtgcccgagatgtggacgaatgtctgagcagcccctgtggccctggc
acctgtactgatcacgtggcctccttcacctgtgcctgtccacctggttatggaggcttc
cactgtgagattgacttgccagactgcagccccagttcctgcttcaatggagggacctgt
gtggatggcgtgaactccttcagctgtctgtgtcgccccggctacacaggcacacactgc
caatacgaggctgacccctgcttttcccggccctgtctgcacgggggcatttgcaacccc
acccacccaggatttgaatgcacctgccgggagggcttcactgggagtcagtgtcagaac
ccagtggactggtgcagccaggcaccctgtcagaatgggggtcgctgtgtccagactggg
gcttactgcatttgtccacctggatggagtggccgcctgtgcgacatacaaagcctgccc
tgcacggaggccgcagcccagatgggggtgaggttggagcagctgtgtcaggaaggtgga
cagtgcatagacaagggccgctcccactactgtgtgtgtccagagggccgtacgggtagt
cactgtgaacacgaggtggatccctgcacagcccagccttgccagcacgggggcacttgc
cgtggttacatggggggctatgtgtgtgagtgtccagctggctatgctggtgacagttgt
gaggataatatagatgagtgtgcttcccagccctgccagaacggaggctcctgtatcgat
cttgtggcccgctatctctgttcctgtccccctggcacactgggagttctctgtgagatc
aatgaggacgactgtgacccaggcccatccttggactcaggcgtccagtgcctacacaat
ggcacctgtgtggacctggtgggtggcttccgctgtaactgtcccccaggatacacaggt
ctgcactgtgaggcagacatcaatgagtgtcgcccgggtgcctgccatgcagcgcatact
cgggactgcctacaagatccaggtgggcatttccgctgcgtctgccatcctggcttcaca
gggcctcgctgtcagattgctctgtccccctgtgagtcccagccatgtcagcatggaggc
cagtgccgtcacagcctaggccgtggaggtgggctgaccttcacctgtcactgtgtccag
ccattctggggtctgcgttgtgagcgggtggcacgctcttgccgagagctgcagtgccca
gtgggtatcccatgccagcagacagcccgtggaccacgctgcgcttgtcctcccgggctg
tccgggccctcctgccgggtttctagggcgtcaccctcaggagctactaacgccaccagc
tgcgcctctgccccttgtctgcatgggggctcgtgcctacctgtacagagtgtccctttc
ttccgctgtgtatgcgctctgggctggggcggcccgcgttgtgagaccccttccgcagca
gcccctgaggtccctgaggagccacggtgcccgcgagcggcttgccaggccaagcgaggg
gaccagaactgcgatcgggagtgcaacagcccaggctgtggctgggatggcggtgactgc
tcactgaacgtggacgacccctggaggcagtgtgaggcactgcagtgctggcgtctcttc
aacaacagccggtgtgacccggcctgcagctctccagcctgcctctatgacaactttgat
tgctactctggtggccgcgaccgcacctgcaaccccgtttatgagaagtactgcgcggac
cactttgcagatggtcgttgtgaccagggctgcaacactgaggagtgtggctgggatggg
ctagactgtgccagcgaggtcccggcccttttggcccgaggggttctggtcctcacagtt
cttctgcctcctgaagagttgctgcgctccagtgccgactttctgcagcgactcagcgct
attctgcgcacctcactgcgcttccgcttggacgcacgtggccaggccatggtcttcccc
tatcaccggccaagccctggctctgaatcccgggtccgtcgtgagctgggtcctgaggtg
atcggctctgtagtgatgctggagattgacaaccggctctgtctgcagtcagctgagaat
gaccactgcttccctgatgcccagagcgctgctgactacctgggagccttgtcggcagtg
gagcgacttgatttcccatacccacttcgggatgtgcgaggagagccgctggaggcccca
gagcagagcgtgccactgctgccactgctggtggcaggggctgtctttctactcatcatc
ttcatcctgggtgtcatggttgccaggcgcaagcgagagcacagcaccctctggttccct
gagggttttgcattacacaaggacatagctgctggccacaagggccggagggagcctgtg
ggacaagatgcactgggcatgaagaacatggccaagggtgagagtctgatgggggaggtg
gtcacagacttgaatgactcagaatgtccagaggccaagagactgaaggtagaggagccg
ggcatgggtgcagaggaacctgaggactgtcgccagtggacccaacaccacctggttgct
gctgatatccgtgtggcaccagccacagcgctgactcctcctcagggagatgcagatgca
gacggagtggacgtcaacgtccgagggcctgatggcttcaccccacttatgctggcctcc
ttctgtgggggagccctggagccgatgccagctgaggaggatgaggcggatgacacatca
gccagcatcatctcagatctgatctgtcaaggggcccagctcggggcacggactgaccgc
actggcgagaccgccctgcatttggctgcccgctacgctcgagcggatgcagccaagcgt
ctcctggatgctggggcggacaccaacgcccaggatcattcgggccgcacccctctgcac
accgcagtgacagctgatgcccagggtgtcttccagattctcatcaggaaccgctccact
gacctggatgcccgaatggcggatggctctactgcactgatcctggcagcccgcctggca
gtggagggcatggtggaagagctcatcgccagccatgccgacgtcaatgcagtggatgag
cttgggaaatctgccttacactgggctgcagctgtgaacaacgtggaggctaccttggct
ctgctgaaaaatggagccaacaaggacatgcaggacagcaaggaggagacgccgctgttc
ttggccgctcgggagggcagctatgaggctgccaagctgctgctggatcatctcgccaac
cgggagatcacagatcacttggacaggctgccccgggacgtggcccaggagcggctgcac
caggacattgtgcggttgctggaccagcccagtggacctcgcagtccctctggtccccat
ggcttagggccattgctctgcccacccggggccttccttcctggcctcaaagcagtgcag
tctgggaccaagaagagcaggaggccacctggcaagaccgggctggggccacagggaact
cgtggtcggggcaagaagctgacactagcctgtccaggacctctggcagacagctctgtc
acattgtcaccggtagactcgctggactcaccacggcctttcagtgggccccctgcttcc
cctggaggcttccccttggagggcccctatgccaccacggccaccgcggtgtccttggca
cagctaggcgcaagtcgggcgggtcctctggggcgccagcctcctgggggctgtgtgctc
agctttggtctgctcaatcctgtagctgttcccctcgactgggccaggctgccaccacct
gcccctccagggccctcattcctactgcccctggctccgggaccccagttgctcaaccca
ggaaccccagtttctccccaagagcggcctccaccctacctggctgctccaggacatgga
gaggaatatcctgcagtaggaacccgcagtagccccaccaaggcccgcttcctgcgggtt
cccagcgagcatccttatttgaccccgtctcctgagtccccagagcactgggccagcccg
tcccctccatccctctcagactggtctgactcaacacctagcccagcaactgctaccagt
gccacagcctctggagccctgcctgctcagccacaccccatatctgttccctccctccct
cagtcccagactcagctgggaccccaaccagaagttacccccaagaggcaggtgatggcc
taa

DBGET integrated database retrieval system