KEGG   Mus caroli (Ryukyu mouse): 110290757
Entry
110290757         CDS       T05910                                 

Gene name
Pld1
Definition
(RefSeq) phospholipase D1 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00564  Glycerophospholipid metabolism
mcal00565  Ether lipid metabolism
mcal01100  Metabolic pathways
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04666  Fc gamma R-mediated phagocytosis
mcal04724  Glutamatergic synapse
mcal04912  GnRH signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05200  Pathways in cancer
mcal05212  Pancreatic cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110290757 (Pld1)
   00565 Ether lipid metabolism
    110290757 (Pld1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110290757 (Pld1)
   04072 Phospholipase D signaling pathway
    110290757 (Pld1)
   04071 Sphingolipid signaling pathway
    110290757 (Pld1)
   04024 cAMP signaling pathway
    110290757 (Pld1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110290757 (Pld1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110290757 (Pld1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110290757 (Pld1)
   04928 Parathyroid hormone synthesis, secretion and action
    110290757 (Pld1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110290757 (Pld1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290757 (Pld1)
   05231 Choline metabolism in cancer
    110290757 (Pld1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110290757 (Pld1)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     110290757 (Pld1)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110290757 (Pld1)
 Endosome - Golgi transport
  Others
   Others
    110290757 (Pld1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH
Other DBs
NCBI-GeneID: 110290757
NCBI-ProteinID: XP_021013134
Ensembl: MGP_CAROLIEiJ_G0024893
UniProt: A0A6P5PFB2
LinkDB
Position
3
AA seq 1074 aa
MSLKSKTRVNTSTLQKIATDMSNLIENLDTRELHFEGEEVEYDTSPGDPKAQEECIPFSS
IYNTQGFKEPNIQTYLSGCPVKAQVLEVERFTSTSRVPSINLYTIELTHGEFTWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTKRHTFRRQNVKEEPREMPSLPRSSENAIQEEQFFGRR
KQLEDYLTKILKMPMYRNYHATTEFLDVSQLSFIHDLGPKGLEGMIMKRSGGHRIPGVNC
CGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFSIKVGRKETETKYGLRIN
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGADFLKEHRFGSYAALHENMLAKWYVNAKG
YFEDIANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGLSLGSLTAASVESMESLSLKDKHEFHKKEPISKI
VDETDMKLKGIGKSRKFSKFSLYRQLHRHHLHNADSISSIDSTSSYFSHCRSHQNLIHGL
KPHLKLFHPSSESEQGLTRHSTDTGSIRSVQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIGSVVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLL
PKSQATAHELRYQVPGAVPAKVQLLRSAADWSAGIKHHEESIHAAYIHVIENSKHYIYIE
NQFFISCADDKVVFNKVGDAIAQRILKAHREGQRYRVYIVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGESSILEQLKPELGNKWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARDLRLECF
RLVLGYLSDPSEDLQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPILAKEDRLRAEEELRKIRGFLVQFPLYFLSEENLLPSVGTKEAIVPMEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaaagcaagaccagggtgaacacgtctacactgcagaaaatcgccacagat
atgagcaacctcatagaaaatctcgacacccgggagcttcattttgagggagaggaggtg
gaatatgacacatctccaggagaccccaaggctcaggaagagtgcatcccattctcttct
atttacaacactcaaggatttaaagagcccaacatccagacctacctctctggctgtcct
gtaaaagcacaagtactggaagtggagcgcttcacatcgacctcaagggtgccaagtatc
aacctgtacacgatcgagttaacgcacggggaattcacgtggcaagttaagaggaaattc
aagcacttccaagagtttcacagagagctgctcaagtacaaagccttcatccggatcccc
atccccaccaaaagacatacatttagaagacaaaatgtcaaagaagaaccccgagagatg
cccagtctgccccgttcatcagaaaacgcaatccaggaggagcagttctttggcaggagg
aagcaactggaagattacttgacaaaaatactaaaaatgcccatgtacagaaattatcac
gccacgacagagttccttgatgtaagccagctgtctttcatccatgatctgggaccaaag
ggcctggaaggcatgatcatgaaaaggtctgggggacacaggataccaggtgtgaattgc
tgtggccatggacgagcctgctaccggtggtcaaagaggtggttgatagtgaaggactct
ttcctgctgtatatgaaaccagatagcggggctattgccttcgtcctccttgtagataaa
gaattcagcatcaaagtgggaaggaaagagacagaaacgaaatatggacttcggatcaat
aatctttcaaggacactgattttaaaatgtaacagctacagacacgcccggtggtgggga
ggcgccatcgaggagtttatccagaagcatggcgctgacttcctcaaagaacatcgcttc
gggtcctacgctgctcttcatgagaacatgttagctaagtggtatgtgaacgccaaaggt
tactttgaagacatcgcaaatgcgatggaagaggcttcggaagagatttttatcacagac
tggtggttaagtccagaaatcttcctgaagcgcccagtggtggaaggcaaccgctggagg
ctggactgcatcctcaaacggaaagcacaacaaggtgtgcggatcttcataatgctttac
aaagaggtggagctagccctcgggatcaacagcgagtacagcaagcggacgttgatgcgg
ctgcaccccaacataaaggtgatgagacacccggaccacgtgtcctccagcgtgtacctg
tgggctcaccatgagaagcttgtcattattgaccaatcagtggcttttgtgggtgggatt
gacctggcctacggaaggtgggatgacaatgagcacagactcacagacgtgggcagtgtc
aagcgggtcacctcaggactgtctctgggctccctcacggcagcatcagtagagtctatg
gaatccttaagcctcaaggataaacatgaatttcataaaaaggagcccatctcaaagatt
gttgatgagaccgacatgaagctgaaagggataggaaagtccaggaaattctccaaattt
agtctctatcgccagctgcaccgtcaccacctgcacaacgcggacagcatcagcagcatc
gacagcacctccagttattttagccactgtagaagtcatcagaatttaatccatgggtta
aagccccacttgaaactctttcacccttccagtgagtctgagcaggggctcactaggcac
agcactgacactggctccatccgcagcgtgcagaccggagtgggagaactccatggggag
actaggttttggcatgggaaggattactgcaactttgtcttcaaggactgggttcagctg
gacaaaccttttgctgatttcatcgacaggtactctaccccccggatgccttggcatgat
attggctctgtggtccatggaaaggcagctcgggatgtggctcgacacttcatccagcgc
tggaacttcactaagattatgaagccaaaataccgctccctttcttatcccttcctgcta
ccaaagtctcaagcgacagcgcacgagttgaggtatcaggtgccaggggccgtccccgcc
aaagtgcagttgctccgatctgctgctgattggtctgctggtataaagcaccatgaggaa
tctatccacgctgcctacatccatgtaatagagaacagcaagcactacatttatattgaa
aaccaatttttcataagctgtgctgatgataaagttgtgttcaacaaggtgggagatgct
atcgcccagagaatcctgaaagcccacagggaaggccagagatatcgggtgtacattgtg
ataccgctgctgccaggattcgagggagacatttccacaggcggggggaacgctctacag
gcaataatgcacttcaactacagaaccatgtgcagaggggagagctccatccttgaacag
ttaaagccagagcttggtaataagtggataaattacatatcgttttgtggtctgagaaca
catgcagagctggaaggaaacctagtcaccgagctcatctacgtccacagcaagttgtta
attgctgatgacaacacagttattattggttctgccaacatcaatgaccggagcatgctg
gggaagcgagacagcgaaatggctgtcatagtgcaggacacagagacggtcccatcggtg
atggatggaaaagaatatcaagctggtcgctttgcccgagaccttcgcctggagtgcttc
agacttgtcctgggttatctttctgacccaagtgaggaccttcaggatcctgtgagtgac
aaattctttaaggagatttgggtttcaacagcagctcgaaacgctaccatatatgataag
gtcttccggtgccttcccaatgatgaagtacacaatttaatccagttgcgggactttata
aacaagcccatattagcaaaagaagatcgccttcgagccgaggaagaactgaggaagatc
cgagggttcttggtgcagttccctctctatttcttatcagaggaaaacctgctgccttcc
gttggaaccaaagaagccattgtgcctatggaggtttggacttaa

KEGG   Mus caroli (Ryukyu mouse): 110304819
Entry
110304819         CDS       T05910                                 

Gene name
Pld2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00564  Glycerophospholipid metabolism
mcal00565  Ether lipid metabolism
mcal01100  Metabolic pathways
mcal04014  Ras signaling pathway
mcal04024  cAMP signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04666  Fc gamma R-mediated phagocytosis
mcal04724  Glutamatergic synapse
mcal04912  GnRH signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05200  Pathways in cancer
mcal05212  Pancreatic cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110304819 (Pld2)
   00565 Ether lipid metabolism
    110304819 (Pld2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110304819 (Pld2)
   04072 Phospholipase D signaling pathway
    110304819 (Pld2)
   04071 Sphingolipid signaling pathway
    110304819 (Pld2)
   04024 cAMP signaling pathway
    110304819 (Pld2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110304819 (Pld2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110304819 (Pld2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110304819 (Pld2)
   04928 Parathyroid hormone synthesis, secretion and action
    110304819 (Pld2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110304819 (Pld2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304819 (Pld2)
   05231 Choline metabolism in cancer
    110304819 (Pld2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110304819 (Pld2)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     110304819 (Pld2)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110304819 (Pld2)
 Endosome - Golgi transport
  Others
   Others
    110304819 (Pld2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 110304819
NCBI-ProteinID: XP_021032089
Ensembl: MGP_CAROLIEiJ_G0016638
UniProt: A0A6P5QTI7
LinkDB
Position
11
AA seq 932 aa
MTVTQNLFPYGDYLNSSQLHMEPDEVDTLREGEDPADRMHPYLAIYDLQPLKAHPLVFAP
GVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLQRHKVLM
SLLPLARFAVTHSPAREEANEDIPSLPRGGSEGSARHTASKQKYLENYLNRLLTMSFYRN
YHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGFTFCGRDQVCYRWSKRWLVVK
DSFLLYMRPETGAISFVQLFDPGFEVQVGKRSTETRYGVRIDTSHRSLILKCSSYRQARW
WGQEITELAQGPGRDFLQLHQHDSYAPPRPGTLTRWFVNGAGYFAAVADAILRAQEEIFI
TDWWLSPEIYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRTLM
LLHPNIKVMRHPDLVTLWAHHEKLLVVDQVVAFLGGLDLAFGRWDDVQYRLTDLGDPSEP
VHLQTPTLGSDPAATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWR
DVGVVVHGVAARDLARHFIQRWNFTKTTKARYKTPLYPYLLPKSTSTANHLPFIIPGGQC
ATVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEI
VDRILKAHEQGQCFRVYLLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRL
KAAMGTAWRDYMSICGLRTHGELGGHPISELIYIHSKMLIADDRTVIIGSANINDRSLLG
KRDSELAILIKDTEMEPSLMDGVEYQAGRFALSLRKHCFSVILGANTRPDLDLRDPVCDD
FFQLWQETAENNATIYEQIFRCLPSNATRSLRALREYVAVESLATVSPSLAQSELAHIQG
HLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2799 nt   +upstreamnt  +downstreamnt
atgactgtaacccagaacctctttccctatggggactatctgaactccagccagttgcac
atggagccagatgaggttgacactctgagggaaggagaggatccagctgatcgaatgcat
ccctatctggccatctatgaccttcagcctctgaaagcacaccccttggtgtttgcccct
ggggtccctgttatagcccaggtggtgggcacggaaagatacaccagcggatccaaggtg
ggaacctgtactctatattctgttcgcttgacgcatggtgactttacctggacaaccaag
aagaagttccgacactttcaggagctgcatcgggacctccagagacacaaagtcttgatg
agtctgctccctctggctcgctttgctgtgacccattctccagcccgagaggaagccaac
gaggatataccctccctaccccgaggaggttctgagggctctgccagacacacagccagc
aaacagaaatacctggaaaattacctcaaccgcctcctgaccatgtctttctatcgcaat
taccacgccatgacagaatttctggaagtcagtcaactttcctttatcccagaccttggc
tccaaaggactggaaggggtgatccggaagcgctcaggcgggcatcgagttcccggcttc
accttctgtggccgagaccaagtttgttatcggtggtccaagaggtggctggtggtgaag
gactccttcctgctctacatgcgcccggagaccggtgccatctcatttgttcagcttttt
gaccctggctttgaggtccaggtcggaaaaaggagcacagagacgcggtatggggtgagg
atcgatacctcccacaggtccctgattctcaaatgcagcagctaccggcaggcacggtgg
tggggccaggagatcacggagctggcacagggtccgggcagagattttctacagctgcat
cagcatgatagctatgccccaccccggcccggcaccctgacccggtggtttgtgaatggg
gcaggttactttgctgctgtggcagatgccatcctgcgagctcaagaggagattttcatc
acagactggtggttgagtcctgaaatttacctaaagcgtccagcccattccgacgactgg
agactggacattatgctcaagaggaaggcggaagaaggtgtccgagtttccatcctgctg
tttaaggaagtggagctggccttgggcatcaacagtggctacagcaagaggacactgatg
ctgctgcaccccaacataaaggtgatgcgacacccagaccttgtgacactgtgggcccat
catgagaagctcctggtggtagaccaagtggtggcgttcttgggcgggctggacctggcc
ttcggccgctgggatgacgtgcaataccgactgactgacctgggggacccctctgaacct
gtacatttacagactcccacactaggttcagaccctgcagccactccagacctctcgcat
aaccaattcttctggctgggaaaggactacagcaacctcatcaccaaggactgggtacag
ctggaccggccttttgaagatttcatcgacagggaaaccacacccaggatgccatggagg
gatgttggagtggttgtacacggagtagctgccagggaccttgcccggcacttcatccag
cgctggaatttcaccaagaccaccaaggccaggtataagacacctttgtacccctacctg
ctgcccaagtccaccagcactgcaaaccatctccccttcataatcccaggcgggcagtgt
gccactgtgcaggtcttgaggtctgtggatcgatggtcagcagggacattggagaactcc
atcctcaatgcctacctacataccatccgagagagccagcactttctctacattgagaat
cagttcttcattagctgctcagatgggcgaacagttctgaacaaggtgggcgatgagatt
gtggacagaatcctgaaggctcatgaacaggggcagtgttttcgagtctacttgcttctg
cctttgctccctggctttgagggggacatctccacagggggtggtaactccatccaggct
attctgcacttcacctacaggaccctgtgtcgtggggaatattcaatcttacatcgtctc
aaagcagccatggggacagcgtggcgagattacatgtccatctgtgggcttcgcacacat
ggagagctgggtgggcacccaatctctgagctcatctatatccacagcaagatgctcatt
gcggacgacagaacagtcatcatcggttctgcgaacatcaatgacaggagcttactgggg
aagcgtgacagtgagctagccatcctgatcaaggacacagaaatggaaccatccctcatg
gatggggtggagtaccaggcaggcagatttgccttgagtttgcggaagcactgtttcagt
gtgattcttggggcaaatacccggccagacctggatctccgagaccctgtctgtgatgac
ttcttccagctgtggcaagaaacagcggagaacaatgccaccatctatgagcagatcttc
cgctgcctgccgtccaacgctacccgttccctgcgggctctccgggagtacgtggctgta
gagtccttggctacagtcagcccttctttggctcagtctgagcttgcccacatccagggc
cacctagttcacttccccctcaagtttctggaggacgagtccttgttgcccccactgggg
agtaaagaagggatgatacctttagaagtgtggacatag

DBGET integrated database retrieval system