KEGG   Mus caroli (Ryukyu mouse): 110290775
Entry
110290775         CDS       T05910                                 

Gene name
Gnai3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04360  Axon guidance
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04670  Leukocyte transendothelial migration
mcal04713  Circadian entrainment
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04924  Renin secretion
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04971  Gastric acid secretion
mcal05012  Parkinson disease
mcal05030  Cocaine addiction
mcal05032  Morphine addiction
mcal05034  Alcoholism
mcal05133  Pertussis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110290775 (Gnai3)
   04371 Apelin signaling pathway
    110290775 (Gnai3)
   04071 Sphingolipid signaling pathway
    110290775 (Gnai3)
   04024 cAMP signaling pathway
    110290775 (Gnai3)
   04022 cGMP-PKG signaling pathway
    110290775 (Gnai3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110290775 (Gnai3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110290775 (Gnai3)
   04670 Leukocyte transendothelial migration
    110290775 (Gnai3)
   04062 Chemokine signaling pathway
    110290775 (Gnai3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110290775 (Gnai3)
   04915 Estrogen signaling pathway
    110290775 (Gnai3)
   04914 Progesterone-mediated oocyte maturation
    110290775 (Gnai3)
   04921 Oxytocin signaling pathway
    110290775 (Gnai3)
   04926 Relaxin signaling pathway
    110290775 (Gnai3)
   04935 Growth hormone synthesis, secretion and action
    110290775 (Gnai3)
   04928 Parathyroid hormone synthesis, secretion and action
    110290775 (Gnai3)
   04916 Melanogenesis
    110290775 (Gnai3)
   04924 Renin secretion
    110290775 (Gnai3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110290775 (Gnai3)
  09154 Digestive system
   04971 Gastric acid secretion
    110290775 (Gnai3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110290775 (Gnai3)
   04727 GABAergic synapse
    110290775 (Gnai3)
   04725 Cholinergic synapse
    110290775 (Gnai3)
   04728 Dopaminergic synapse
    110290775 (Gnai3)
   04726 Serotonergic synapse
    110290775 (Gnai3)
   04730 Long-term depression
    110290775 (Gnai3)
   04723 Retrograde endocannabinoid signaling
    110290775 (Gnai3)
  09158 Development and regeneration
   04360 Axon guidance
    110290775 (Gnai3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110290775 (Gnai3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290775 (Gnai3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110290775 (Gnai3)
  09165 Substance dependence
   05030 Cocaine addiction
    110290775 (Gnai3)
   05032 Morphine addiction
    110290775 (Gnai3)
   05034 Alcoholism
    110290775 (Gnai3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110290775 (Gnai3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110290775 (Gnai3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110290775 (Gnai3)
   05163 Human cytomegalovirus infection
    110290775 (Gnai3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110290775 (Gnai3)
   05142 Chagas disease
    110290775 (Gnai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110290775 (Gnai3)
   04031 GTP-binding proteins [BR:mcal04031]
    110290775 (Gnai3)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110290775 (Gnai3)
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110290775 (Gnai3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 110290775
NCBI-ProteinID: XP_021013177
Ensembl: MGP_CAROLIEiJ_G0025520
UniProt: A0A6P5PFH6
LinkDB
Position
3
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggggagaaagcggccaaagaagtgaagctgctgctgctcggc
gctggagaatctggtaaaagtaccatcgtgaaacagatgaaaatcattcatgaggacggc
tattcagaggacgaatgtaaacagtataaagtagttgtctacagcaatactattcagtcc
atcattgcaatcatacgagccatgggacggttgaagattgattttggggaagctgccaga
gcagatgatgcccgacagttatttgttttagctgggagtgctgaagaaggagtcatgact
tcagaactagcaggcgtgattaaacgtttatggcgagatggcggggtgcaagcatgcttt
agcaggtccagggaatatcagctcaatgattctgcttcatactacctaaatgatttggat
agaatatcccagaccaactacattccaactcaacaagatgttcttcggacaagagtgaag
actacaggcattgtggagacccacttcaccttcaaggaactctacttcaaaatgtttgat
gtaggtggccaaagatccgaacgaaaaaagtggattcactgttttgagggagtgaccgca
attatcttttgtgtggctctcagtgattacgaccttgttctggctgaggatgaggaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctctttcttaataagaaagacctttttgaggaaaaaataaagagg
agtccattaacaatctgttatccagaatacacaggttccaatacatacgaagaggcagct
gcttacatccagtgccagtttgaagatctgaaccgaagaaaagataccaaggaggtctac
actcacttcacctgtgccacagacaccaaaaatgtgcagtttgtttttgatgctgttacg
gatgtcatcattaaaaacaacttaaaggaatgtgggctttattga

KEGG   Mus caroli (Ryukyu mouse): 110294623
Entry
110294623         CDS       T05910                                 

Gene name
Gnai1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04360  Axon guidance
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04670  Leukocyte transendothelial migration
mcal04713  Circadian entrainment
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04924  Renin secretion
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04971  Gastric acid secretion
mcal05012  Parkinson disease
mcal05030  Cocaine addiction
mcal05032  Morphine addiction
mcal05034  Alcoholism
mcal05133  Pertussis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110294623 (Gnai1)
   04371 Apelin signaling pathway
    110294623 (Gnai1)
   04071 Sphingolipid signaling pathway
    110294623 (Gnai1)
   04024 cAMP signaling pathway
    110294623 (Gnai1)
   04022 cGMP-PKG signaling pathway
    110294623 (Gnai1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110294623 (Gnai1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110294623 (Gnai1)
   04670 Leukocyte transendothelial migration
    110294623 (Gnai1)
   04062 Chemokine signaling pathway
    110294623 (Gnai1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110294623 (Gnai1)
   04915 Estrogen signaling pathway
    110294623 (Gnai1)
   04914 Progesterone-mediated oocyte maturation
    110294623 (Gnai1)
   04921 Oxytocin signaling pathway
    110294623 (Gnai1)
   04926 Relaxin signaling pathway
    110294623 (Gnai1)
   04935 Growth hormone synthesis, secretion and action
    110294623 (Gnai1)
   04928 Parathyroid hormone synthesis, secretion and action
    110294623 (Gnai1)
   04916 Melanogenesis
    110294623 (Gnai1)
   04924 Renin secretion
    110294623 (Gnai1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110294623 (Gnai1)
  09154 Digestive system
   04971 Gastric acid secretion
    110294623 (Gnai1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110294623 (Gnai1)
   04727 GABAergic synapse
    110294623 (Gnai1)
   04725 Cholinergic synapse
    110294623 (Gnai1)
   04728 Dopaminergic synapse
    110294623 (Gnai1)
   04726 Serotonergic synapse
    110294623 (Gnai1)
   04730 Long-term depression
    110294623 (Gnai1)
   04723 Retrograde endocannabinoid signaling
    110294623 (Gnai1)
  09158 Development and regeneration
   04360 Axon guidance
    110294623 (Gnai1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110294623 (Gnai1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110294623 (Gnai1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110294623 (Gnai1)
  09165 Substance dependence
   05030 Cocaine addiction
    110294623 (Gnai1)
   05032 Morphine addiction
    110294623 (Gnai1)
   05034 Alcoholism
    110294623 (Gnai1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110294623 (Gnai1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110294623 (Gnai1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110294623 (Gnai1)
   05163 Human cytomegalovirus infection
    110294623 (Gnai1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110294623 (Gnai1)
   05142 Chagas disease
    110294623 (Gnai1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110294623 (Gnai1)
   04031 GTP-binding proteins [BR:mcal04031]
    110294623 (Gnai1)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110294623 (Gnai1)
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110294623 (Gnai1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 110294623
NCBI-ProteinID: XP_021018630
Ensembl: MGP_CAROLIEiJ_G0026977
UniProt: A0A6P5PTA4
LinkDB
Position
5
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacattgagcgctgaggacaaggcggccgtggagcgcagcaagatgatcgac
cgcaacctccgggaggacggcgagaaggcggcgcgggaggtcaagctgctgctgctgggt
gctggtgaatctggaaagagtaccattgtgaagcagatgaaaattatccacgaagccggc
tactcagaagaggaatgtaagcagtacaaggcagtggtctatagcaacactatccagtcc
atcatcgccatcattagagccatggggaggttgaaaatcgactttggagactctgctcgg
gcggatgatgctcgccaacttttcgtgcttgctggggctgcagaagaaggctttatgact
gcagagctcgccggtgtcataaagagactgtggaaagacagtggtgtgcaagcctgcttc
aacagatcccgggagtaccagctgaacgattcggcagcctactatctgaatgacttggac
agaatagcacagccaaattatatcccaactcagcaggatgtcctcagaaccagagtgaag
accacaggaattgtggaaacccactttaccttcaaagatcttcattttaaaatgtttgac
gtgggaggtcagaggtcagagcggaagaagtggattcactgctttgaaggagtgaccgcc
atcatcttctgtgtggccctgagtgactatgacctggttcttgctgaagatgaagaaatg
aaccgtatgcatgaaagcatgaagctgttcgatagcatctgtaacaacaagtggtttaca
gatacatccatcatccttttcctaaacaagaaggacctctttgaagagaaaataaaaaag
agtcccctcacgatatgctatccagaatatgcaggctcaaacacatatgaagaagcggcc
gcgtatattcagtgtcagtttgaagacctcaataaaaggaaggacacaaaggaaatttac
acccacttcacgtgcgccacagatacgaagaatgtgcagttcgtgttcgatgctgtaaca
gacgtcatcataaagaataacctaaaagactgtggtctcttctaa

KEGG   Mus caroli (Ryukyu mouse): 110301809
Entry
110301809         CDS       T05910                                 

Gene name
Gnai2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2 isoform X1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04360  Axon guidance
mcal04371  Apelin signaling pathway
mcal04540  Gap junction
mcal04611  Platelet activation
mcal04670  Leukocyte transendothelial migration
mcal04713  Circadian entrainment
mcal04723  Retrograde endocannabinoid signaling
mcal04724  Glutamatergic synapse
mcal04725  Cholinergic synapse
mcal04726  Serotonergic synapse
mcal04727  GABAergic synapse
mcal04728  Dopaminergic synapse
mcal04730  Long-term depression
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04916  Melanogenesis
mcal04921  Oxytocin signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04924  Renin secretion
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal04971  Gastric acid secretion
mcal05012  Parkinson disease
mcal05030  Cocaine addiction
mcal05032  Morphine addiction
mcal05034  Alcoholism
mcal05133  Pertussis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05163  Human cytomegalovirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110301809 (Gnai2)
   04371 Apelin signaling pathway
    110301809 (Gnai2)
   04071 Sphingolipid signaling pathway
    110301809 (Gnai2)
   04024 cAMP signaling pathway
    110301809 (Gnai2)
   04022 cGMP-PKG signaling pathway
    110301809 (Gnai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110301809 (Gnai2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110301809 (Gnai2)
   04670 Leukocyte transendothelial migration
    110301809 (Gnai2)
   04062 Chemokine signaling pathway
    110301809 (Gnai2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110301809 (Gnai2)
   04915 Estrogen signaling pathway
    110301809 (Gnai2)
   04914 Progesterone-mediated oocyte maturation
    110301809 (Gnai2)
   04921 Oxytocin signaling pathway
    110301809 (Gnai2)
   04926 Relaxin signaling pathway
    110301809 (Gnai2)
   04935 Growth hormone synthesis, secretion and action
    110301809 (Gnai2)
   04928 Parathyroid hormone synthesis, secretion and action
    110301809 (Gnai2)
   04916 Melanogenesis
    110301809 (Gnai2)
   04924 Renin secretion
    110301809 (Gnai2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110301809 (Gnai2)
  09154 Digestive system
   04971 Gastric acid secretion
    110301809 (Gnai2)
  09156 Nervous system
   04724 Glutamatergic synapse
    110301809 (Gnai2)
   04727 GABAergic synapse
    110301809 (Gnai2)
   04725 Cholinergic synapse
    110301809 (Gnai2)
   04728 Dopaminergic synapse
    110301809 (Gnai2)
   04726 Serotonergic synapse
    110301809 (Gnai2)
   04730 Long-term depression
    110301809 (Gnai2)
   04723 Retrograde endocannabinoid signaling
    110301809 (Gnai2)
  09158 Development and regeneration
   04360 Axon guidance
    110301809 (Gnai2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110301809 (Gnai2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301809 (Gnai2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110301809 (Gnai2)
  09165 Substance dependence
   05030 Cocaine addiction
    110301809 (Gnai2)
   05032 Morphine addiction
    110301809 (Gnai2)
   05034 Alcoholism
    110301809 (Gnai2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110301809 (Gnai2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110301809 (Gnai2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110301809 (Gnai2)
   05163 Human cytomegalovirus infection
    110301809 (Gnai2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110301809 (Gnai2)
   05142 Chagas disease
    110301809 (Gnai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110301809 (Gnai2)
   04031 GTP-binding proteins [BR:mcal04031]
    110301809 (Gnai2)
Exosome [BR:mcal04147]
 Exosomal proteins
  Proteins found in most exosomes
   110301809 (Gnai2)
GTP-binding proteins [BR:mcal04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    110301809 (Gnai2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 110301809
NCBI-ProteinID: XP_021028133
Ensembl: MGP_CAROLIEiJ_G0032656
UniProt: A0A6P5QD66
LinkDB
Position
9
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGML
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcagccgagcgctctaaaatgatcgac
aagaacctgcgggaggacggcgagaaggcggcgcgggaggtgaagttgcttctgttaggt
gctggagaatcagggaagagcaccatcgtcaagcagatgaagatcatccatgaagatggc
tactcagaagaggagtgccggcagtaccgtgccgtggtctacagcaacaccatccagtct
atcatggccatcgtgaaggccatgggcaacctgcagattgactttgctgacccccagcgt
gcggatgatgccaggcagctgttcgccctgtcctgtgctgcagaggagcaaggaatgctt
cctgaagacctgtccggtgtcatccggaggctctgggctgaccacggtgtgcaagcctgc
tttggccgctcacgagaataccagctcaatgactcagccgcttactacctgaatgatctg
gagcgcattgcacagagtgactacatccctacacagcaggatgtgctgcggacccgtgtg
aagaccacgggcatcgtggagacacacttcaccttcaaggacttacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccattgctttgagggagtcacg
gccatcatcttctgtgtcgccttgagcgcctatgacttggtgctggctgaggatgaggag
atgaaccgcatgcatgagagcatgaagctgtttgacagcatctgcaacaacaagtggttc
acagacacctccatcatcctcttcctcaacaagaaggacctgtttgaagaaaagatcaca
cagagccccctgaccatctgtttccctgagtacacaggggccaacaagtatgacgaggca
gccagctacatccagagcaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagtttgtgttcgatgccgtc
actgacgtcatcatcaagaacaacctgaaggactgtggcctcttctga

DBGET integrated database retrieval system