KEGG   Mus caroli (Ryukyu mouse): 110290783
Entry
110290783         CDS       T05910                                 

Gene name
Arnt
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform X1
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal04934  Cushing syndrome
mcal05200  Pathways in cancer
mcal05204  Chemical carcinogenesis
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110290783 (Arnt)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290783 (Arnt)
   05204 Chemical carcinogenesis
    110290783 (Arnt)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110290783 (Arnt)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110290783 (Arnt)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110290783 (Arnt)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110290783 (Arnt)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 110290783
NCBI-ProteinID: XP_021013185
Ensembl: MGP_CAROLIEiJ_G0025343
UniProt: A0A6P5PIT6
LinkDB
Position
3
AA seq 790 aa
MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEVEVNTKFL
RCDDDQMCNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRVLDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKTREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIP
RSQLGPTANLSLEMGTGQLPSRQQQQQTELDMVPGRDGLASYNHSQVSVQPVASAGSEHS
KPLEKSEGLFAQDRDPRFPEIYPSITADQSKGISSSTVPATQQLFSQGSSFPPNPRPAEN
FRNSGLTPPVTIVQPSSSAGQILAQISRHSNPAQGSAPTWTSSSRPGFSAQQVPTQATAK
TRSSQFGVNNFQTSSSFSAMSLPGAPTASSGTAAYPALPNRGSNFPPETGQTTGQFQART
AEGVGVWPQWQGQQPHHRSSSSEQHVQQTQAQAPSQPEVFQEMLSMLGDQSNTYNNEEFP
DLTMFPPFSE
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggcggcgactacagctaacccagaaatgacatcagatgtaccatcgctgggtcccacc
attgcttctggaaaccctggacctgggattcaaggtggaggagctgttgtacagagggct
attaagcgacggtcagggctggattttgatgatgaagtagaagtgaacactaaatttttg
agatgcgatgatgaccagatgtgtaatgacaaagaacggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcatagtgaaatagaacggcgg
cgacggaacaagatgacagcttacatcacagaactgtcagacatggtacctacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggccgtgtctcacatgaag
tccttgaggggaactggcaacacatctactgatggctcctacaagccatctttcctcact
gatcaggaactgaaacatttgatcttggaggcagcagatggctttctgtttattgtctcc
tgtgagactggacgggtggtgtatgtctctgactcagtgactcccgttttgaatcagcca
cagtctgaatggttcgggagcacactgtatgatcaggtgcacccagatgatgtggataaa
cttcgagagcagctctctacatcagaaaatgccctaacagggcgggtcctggatctgaag
actggaacagtgaaaaaggaaggccagcagtcttccatgaggatgtgcatgggctcacga
aggtcgttcatctgccgcatgaggtgtggcaccagctccgtggaccctgtttccatgaat
agactgagctttttgaggaacagatgcaggaatggacttggctctgtgaaggaaggagaa
cctcactttgtggtagtccactgcacaggctacatcaaggcctggccaccagcaggtgtc
tccctcccagatgatgacccggaggctggccaggggagcaaattctgcctagtggccatt
ggcaggctgcaggtaactagttctcccaactgtacagacatgagtaacatttgtcagcca
acagagttcatctcccgacacaacattgaagggatattcacttttgtagaccatcgttgt
gtggctactgttggctaccagccacaggagctcttagggaagaatattgtagaattttgt
catcctgaagaccaacaacttctaagagacagctttcagcaggtggtgaaattaaaaggc
caggtgctgtccgtcatgttccgattccgatctaagacccgagaatggctgtggatgaga
acgagctcctttaccttccaaaacccttattcagatgaaattgagtatattatctgcacc
aacaccaatgtgaagaactctagccaggaaccacggcctacactgtccaacaccattcca
aggtcacagctaggtccgacagccaatttatccctagagatgggtacagggcagctgcca
tccaggcagcagcagcagcaaacagaactggatatggtaccaggaagagatgggctggcc
agctataatcattcccaggtttctgtccagcctgtggcaagtgcaggatcagaacacagc
aagccccttgagaagtcagaaggtctctttgcacaggacagagatccaaggtttccagaa
atctatcccagcatcactgcagatcagagtaaaggcatctcctccagcactgtccctgcc
acccaacagctgttctcccagggcagctcattccctcctaacccccggccggcagagaat
ttcaggaatagtggtcttacccctcctgtaaccattgtccagccatcatcttctgcagga
cagatactggcccagatttcacgtcactccaaccctgcccagggatcagcgccgacctgg
acctctagctcccgcccaggcttctccgcccagcaggtgcccacccaggctacagccaag
actcgctcttcccaatttggtgtgaacaactttcagacttcttcttccttcagtgctatg
tctcttccgggtgctcccactgcctcatctggcactgctgcctaccctgctctccccaac
cgtggctccaactttcctcctgagactggacagaccacaggacagttccaggcccggacg
gcagagggcgtgggtgtctggccacagtggcagggccagcagccccatcatcggtctagt
tccagtgagcagcatgttcagcagacacaagcacaagcacctagccagcctgaggtcttt
caagaaatgctgtccatgctgggagaccaaagcaacacctacaacaatgaagaatttccc
gatctaactatgtttccccccttttccgaatag

KEGG   Mus caroli (Ryukyu mouse): 110298280
Entry
110298280         CDS       T05910                                 

Gene name
Arnt2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298280 (Arnt2)
   05202 Transcriptional misregulation in cancer
    110298280 (Arnt2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110298280 (Arnt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110298280 (Arnt2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110298280 (Arnt2)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-GeneID: 110298280
NCBI-ProteinID: XP_021023077
Ensembl: MGP_CAROLIEiJ_G0029947
UniProt: A0A6P5Q2Y7
LinkDB
Position
7
AA seq 712 aa
MATPAAVNPPEMASDIPGSVALPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWLLIRTSSFTF
QNPYSDEIEYVICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASASGSQQIYSQGSPFPAGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNISQISRQLNQGQVAWTGSRPPFPGQPSKTQSSAFGIGSSHP
YPADPSSYSPLSSPAASSPSGNAYPSLANRTPGFAESGQSGGQFQGRPSEVWSQWQSQHH
GQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcaaccccggccgccgtcaaccctccggagatggcgtcagacataccaggatctgtg
gccttgcctgttgcccccatggcggccaccggacaggtgagaatggcaggggccatgcct
gcccgcggaggaaagcgtcgatccggaatggacttcgatgacgaagatggggaaggtccc
agtaaattctcaagagagaaccacagtgagattgagcggcgcaggcggaacaagatgact
caatatattacggaactttctgacatggttcccacctgcagtgcactggctaggaagcca
gacaagctgaccatcctgcgcatggcggtctcgcacatgaagtccatgaggggcactggc
aacaaatcgactgacggcgcatacaagccttccttcctcactgagcaggaactgaagcat
ctcatcctggaagccgctgatggatttctgtttgtggtggcagctgagacagggagagtc
atctatgtgtctgattcggtcactcctgtcctgaaccagccacagtcagagtggtttggg
agcacgctttatgagcaggtgcaccctgatgacgtggagaaactgagggaacagctgtgc
acttcagaaaactccatgacaggccgcatcctggacctgaagactgggacagtgaagaaa
gagggacagcagtcatccatgcgcatgtgtatgggctctcggcgctccttcatctgtagg
atgaggtgtggaaacgctcccttggaccacctgcctttgaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccagtatgctgtggtc
cactgcacaggttacatcaaggcttggccaccagcaggaatgaccatacccgaagaagac
gctgatgtcggacaaggcagtaaatattgcctcgtggcaattgggaggctccaggtgacc
agctctcctgtgtgcatggacatgagtggcatgtcagtgcccacagagttcctgtcacgg
cacaactctgatgggatcatcacatttgtggacccaagatgcatcagtgtgattggctac
cagccccaggaccttctgggaaaggatattttggaattttgccaccctgaggatcagagc
cacctacgggagagcttccagcaggtggttaagctgaagggccaagtgctgtcggtcatg
tatcggttccgcaccaagaaccgggagtggctgttgatccgtaccagcagcttcaccttc
cagaacccctactctgatgagatcgagtacgtcatctgcaccaacaccaatgtcaagcaa
cttcagcaacagcaggcagaactggaggtacatcagcgagatgggctgtcgtcatatgac
ttatctcaggtcccagtacccaacctacccgctggtgttcacgaggccgggaagtctgtg
gaaaaggcagatgcaatcttctcccaagagagagaccctcgttttgctgagatgtttgca
ggcatcagtgcatcggagaagaagatgatgagctcagcctcagcatcaggcagtcagcag
atctactcccaaggaagtccattccctgccgggcactcgggcaaggccttcagctcttcc
gtggtccatgtgcctggagtgaatgacattcagtcctcctcctcaacgggacagaacata
tcccagatctctcggcagctgaaccagggccaggtggcatggacaggcagccgtccaccg
ttcccagggcagcccagcaagacgcagtcatctgccttcggaattggatcaagccaccct
tacccagctgacccttcatcctacagtcctctctccagcccagctgcctcctcaccaagt
ggaaatgcataccctagtcttgccaacaggactccagggtttgctgagagtggacagagt
ggcgggcagttccagggccggccctcggaggtctggtcccagtggcagagccagcatcac
ggacagcagagcggtgagcagcactcacaccagcagcctggccagactgaagtgttccag
gacatgctacccatgccgggcgacccgacgcaggggactggcaactataacatcgaggac
tttgctgacctgggcatgttccctccattttctgagtag

DBGET integrated database retrieval system