KEGG   Mus caroli (Ryukyu mouse): 110290798
Entry
110290798         CDS       T05910                                 

Gene name
Pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05146  Amoebiasis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110290798 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110290798 (Pik3ca)
   04014 Ras signaling pathway
    110290798 (Pik3ca)
   04015 Rap1 signaling pathway
    110290798 (Pik3ca)
   04370 VEGF signaling pathway
    110290798 (Pik3ca)
   04630 JAK-STAT signaling pathway
    110290798 (Pik3ca)
   04668 TNF signaling pathway
    110290798 (Pik3ca)
   04066 HIF-1 signaling pathway
    110290798 (Pik3ca)
   04068 FoxO signaling pathway
    110290798 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    110290798 (Pik3ca)
   04072 Phospholipase D signaling pathway
    110290798 (Pik3ca)
   04071 Sphingolipid signaling pathway
    110290798 (Pik3ca)
   04024 cAMP signaling pathway
    110290798 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    110290798 (Pik3ca)
   04152 AMPK signaling pathway
    110290798 (Pik3ca)
   04150 mTOR signaling pathway
    110290798 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110290798 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    110290798 (Pik3ca)
   04218 Cellular senescence
    110290798 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110290798 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    110290798 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110290798 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110290798 (Pik3ca)
   04613 Neutrophil extracellular trap formation
    110290798 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    110290798 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    110290798 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    110290798 (Pik3ca)
   04660 T cell receptor signaling pathway
    110290798 (Pik3ca)
   04662 B cell receptor signaling pathway
    110290798 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    110290798 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    110290798 (Pik3ca)
   04670 Leukocyte transendothelial migration
    110290798 (Pik3ca)
   04062 Chemokine signaling pathway
    110290798 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110290798 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    110290798 (Pik3ca)
   04929 GnRH secretion
    110290798 (Pik3ca)
   04915 Estrogen signaling pathway
    110290798 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    110290798 (Pik3ca)
   04917 Prolactin signaling pathway
    110290798 (Pik3ca)
   04926 Relaxin signaling pathway
    110290798 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    110290798 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    110290798 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110290798 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110290798 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    110290798 (Pik3ca)
   04722 Neurotrophin signaling pathway
    110290798 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110290798 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    110290798 (Pik3ca)
   04380 Osteoclast differentiation
    110290798 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    110290798 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    110290798 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290798 (Pik3ca)
   05206 MicroRNAs in cancer
    110290798 (Pik3ca)
   05205 Proteoglycans in cancer
    110290798 (Pik3ca)
   05203 Viral carcinogenesis
    110290798 (Pik3ca)
   05230 Central carbon metabolism in cancer
    110290798 (Pik3ca)
   05231 Choline metabolism in cancer
    110290798 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110290798 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110290798 (Pik3ca)
   05212 Pancreatic cancer
    110290798 (Pik3ca)
   05225 Hepatocellular carcinoma
    110290798 (Pik3ca)
   05226 Gastric cancer
    110290798 (Pik3ca)
   05214 Glioma
    110290798 (Pik3ca)
   05221 Acute myeloid leukemia
    110290798 (Pik3ca)
   05220 Chronic myeloid leukemia
    110290798 (Pik3ca)
   05218 Melanoma
    110290798 (Pik3ca)
   05211 Renal cell carcinoma
    110290798 (Pik3ca)
   05215 Prostate cancer
    110290798 (Pik3ca)
   05213 Endometrial cancer
    110290798 (Pik3ca)
   05224 Breast cancer
    110290798 (Pik3ca)
   05222 Small cell lung cancer
    110290798 (Pik3ca)
   05223 Non-small cell lung cancer
    110290798 (Pik3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110290798 (Pik3ca)
   05017 Spinocerebellar ataxia
    110290798 (Pik3ca)
   05020 Prion disease
    110290798 (Pik3ca)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110290798 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110290798 (Pik3ca)
   04932 Non-alcoholic fatty liver disease
    110290798 (Pik3ca)
   04931 Insulin resistance
    110290798 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110290798 (Pik3ca)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110290798 (Pik3ca)
   05135 Yersinia infection
    110290798 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    110290798 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110290798 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    110290798 (Pik3ca)
   05161 Hepatitis B
    110290798 (Pik3ca)
   05160 Hepatitis C
    110290798 (Pik3ca)
   05171 Coronavirus disease - COVID-19
    110290798 (Pik3ca)
   05164 Influenza A
    110290798 (Pik3ca)
   05162 Measles
    110290798 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    110290798 (Pik3ca)
   05163 Human cytomegalovirus infection
    110290798 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110290798 (Pik3ca)
   05169 Epstein-Barr virus infection
    110290798 (Pik3ca)
   05165 Human papillomavirus infection
    110290798 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110290798 (Pik3ca)
   05142 Chagas disease
    110290798 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110290798 (Pik3ca)
   01524 Platinum drug resistance
    110290798 (Pik3ca)
   01522 Endocrine resistance
    110290798 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110290798 (Pik3ca)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110290798 (Pik3ca)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110290798 (Pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321
Other DBs
NCBI-GeneID: 110290798
NCBI-ProteinID: XP_021013222
Ensembl: MGP_CAROLIEiJ_G0024915
UniProt: A0A6P5PIV6
LinkDB
Position
3
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPID
SFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcttcgggtgaactgtggggcatccacttgatgcccccacgaatc
ctagtggaatgtttactccccaatggaatgatagtgactttagaatgcctccgtgaggcc
acactagtcaccatcaaacatgaactgttcaaagaggccaggaaataccctctccatcag
cttctgcaagatgaaacttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacggctttgtgaccttcggctttttcaaccctttttaaaa
gttattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgtt
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtccaagactttcga
aggaacattctgaatgtttgcaaagaagctgtggacctgcgggatctcaactcgcctcat
agcagagcaatgtatgtctaccctccaaatgtcgagtcttccccagaactgccaaagcac
atctacaacaagttagataaaggacaaatcatagtggtgatttgggtaatagtctctcca
aacaacgacaagcagaagtacactctgaagatcaaccatgactgtgtgccagagcaagtc
attgctgaagccatcaggaaaaagactcggagcatgttgttgtcctctgagcagctgaaa
ctctgtgtcttagaatatcagggcaagtatattctgaaagtgtgtggctgtgacgagtac
ttcctagaaaagtaccctctgagtcagtacaagtacataagaagctgtataatgctgggg
aggatgcccaacttgatgctgatggccaaagaaagcctatactctcagctgccaattgat
agcttcaccatgccttcatactccaggcgcatctccacagccacaccctacatgaatgga
gagacatctacgaaatccctctgggtcataaatagtgcgctcagaataaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cctaggtggaatgaatggctgaattatgacatatacattcctgatcttcctcgtgctgcg
cgcctttgcctttcaatctgctctgttaaaggccgaaagggtgctaaggaggagcactgt
ccgttggcctggggaaacataaacttgtttgattatacagacaccctagtgtccgggaaa
atggctttgaatctctggcctgtaccacatgggttagaagatctgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgattggttc
agcagtgtggtgaagtttccagacatgtctgtgatcgaagaacatgccaattggtccgtg
tcccgagaagctggattcagttactctcatacaggactgagtaacagactagccagagac
aatgagttaagagaaaatgacaaggaacagctccgagcactttgcacccgggacccactg
tctgaaatcactgaacaagagaaagacttcctatggagccacagacactactgcgtaact
attcctgaaatcctacccaaattgcttctgtctgtcaagtggaattccagagacgaagtg
gcccagatgtactgcttagtaaaagattggcctccaatcaaaccagagcaagccatggaa
ctcctggactgtaactatccagatcctatggttcggagttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactttctcagtacctcattcagcttgtacaggtcttaaaa
tatgaacaatatttggataacctgcttgtgagatttttactcaagaaagcattgacaaat
caaaggattggccattttttcttttggcatttaaaatctgagatgcacaataagactgtc
agtcagaggtttggcctgctattggagtcctactgccgtgcctgtgggatgtatctgaag
cacctgaacagacaagtagaggccatggagaagctcatcaacctaacggatatcctcaag
caggagaagaaggatgagacacaaaaggtacagatgaagtttttggttgaacagatgaga
cagccagacttcatggatgctttgcagggttttctgtcccctctgaatcctgctcaccaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagctactgtttcagaacaatgagatcatc
tttaaaaatggcgacgacttacggcaagatatgttaacccttcagatcatccgaatcatg
gagaacatctggcaaaaccaaggccttgaccttcgcatgctaccttatggctgtctatcc
attggggactgtgtgggtctcatcgaggtagtgagaaactctcacaccatcatgcaaatc
cagtgcaaaggaggcctgaagggggcgctgcagttcaacagccacacactgcatcagtgg
ctcaaggacaagaacaagggcgagatatatgatgcagccattgacctgttcactcggtcc
tgcgcggggtactgcgtggcaacctttatcttgggaattggagaccggcacaacagcaac
atcatggtgaaagatgacggacagctgtttcatatagattttgggcactttttggatcac
aagaagaaaaaatttggttataagcgggaacgtgtgccgtttgtgttgacgcaggatttc
ttgattgtgattagtaaaggagcacaagagtacaccaagaccagagagtttgagaggttt
caggagatgtgttacaaggcttacctagcgattcggcagcatgccaatctcttcatcaac
cttttttcaatgatgcttggctctggaatgccagaactgcaatcttttgatgacattgca
tatatccgaaagactctagccttggacaaaactgagcaagaagctttggaatatttcaca
aagcaaatgaatgatgcacatcatggtggatggacgacaaaaatggattggatcttccac
accatcaagcagcatgcattgaactga

KEGG   Mus caroli (Ryukyu mouse): 110292183
Entry
110292183         CDS       T05910                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05146  Amoebiasis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110292183 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110292183 (Pik3cd)
   04014 Ras signaling pathway
    110292183 (Pik3cd)
   04015 Rap1 signaling pathway
    110292183 (Pik3cd)
   04370 VEGF signaling pathway
    110292183 (Pik3cd)
   04630 JAK-STAT signaling pathway
    110292183 (Pik3cd)
   04668 TNF signaling pathway
    110292183 (Pik3cd)
   04066 HIF-1 signaling pathway
    110292183 (Pik3cd)
   04068 FoxO signaling pathway
    110292183 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    110292183 (Pik3cd)
   04072 Phospholipase D signaling pathway
    110292183 (Pik3cd)
   04071 Sphingolipid signaling pathway
    110292183 (Pik3cd)
   04024 cAMP signaling pathway
    110292183 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    110292183 (Pik3cd)
   04152 AMPK signaling pathway
    110292183 (Pik3cd)
   04150 mTOR signaling pathway
    110292183 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110292183 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    110292183 (Pik3cd)
   04218 Cellular senescence
    110292183 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110292183 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    110292183 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110292183 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110292183 (Pik3cd)
   04613 Neutrophil extracellular trap formation
    110292183 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    110292183 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    110292183 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    110292183 (Pik3cd)
   04660 T cell receptor signaling pathway
    110292183 (Pik3cd)
   04662 B cell receptor signaling pathway
    110292183 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    110292183 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    110292183 (Pik3cd)
   04670 Leukocyte transendothelial migration
    110292183 (Pik3cd)
   04062 Chemokine signaling pathway
    110292183 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110292183 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    110292183 (Pik3cd)
   04929 GnRH secretion
    110292183 (Pik3cd)
   04915 Estrogen signaling pathway
    110292183 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    110292183 (Pik3cd)
   04917 Prolactin signaling pathway
    110292183 (Pik3cd)
   04926 Relaxin signaling pathway
    110292183 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    110292183 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    110292183 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110292183 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110292183 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    110292183 (Pik3cd)
   04722 Neurotrophin signaling pathway
    110292183 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110292183 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    110292183 (Pik3cd)
   04380 Osteoclast differentiation
    110292183 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    110292183 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    110292183 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292183 (Pik3cd)
   05206 MicroRNAs in cancer
    110292183 (Pik3cd)
   05205 Proteoglycans in cancer
    110292183 (Pik3cd)
   05203 Viral carcinogenesis
    110292183 (Pik3cd)
   05230 Central carbon metabolism in cancer
    110292183 (Pik3cd)
   05231 Choline metabolism in cancer
    110292183 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110292183 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110292183 (Pik3cd)
   05212 Pancreatic cancer
    110292183 (Pik3cd)
   05225 Hepatocellular carcinoma
    110292183 (Pik3cd)
   05226 Gastric cancer
    110292183 (Pik3cd)
   05214 Glioma
    110292183 (Pik3cd)
   05221 Acute myeloid leukemia
    110292183 (Pik3cd)
   05220 Chronic myeloid leukemia
    110292183 (Pik3cd)
   05218 Melanoma
    110292183 (Pik3cd)
   05211 Renal cell carcinoma
    110292183 (Pik3cd)
   05215 Prostate cancer
    110292183 (Pik3cd)
   05213 Endometrial cancer
    110292183 (Pik3cd)
   05224 Breast cancer
    110292183 (Pik3cd)
   05222 Small cell lung cancer
    110292183 (Pik3cd)
   05223 Non-small cell lung cancer
    110292183 (Pik3cd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110292183 (Pik3cd)
   05017 Spinocerebellar ataxia
    110292183 (Pik3cd)
   05020 Prion disease
    110292183 (Pik3cd)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110292183 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110292183 (Pik3cd)
   04932 Non-alcoholic fatty liver disease
    110292183 (Pik3cd)
   04931 Insulin resistance
    110292183 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110292183 (Pik3cd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110292183 (Pik3cd)
   05135 Yersinia infection
    110292183 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    110292183 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292183 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    110292183 (Pik3cd)
   05161 Hepatitis B
    110292183 (Pik3cd)
   05160 Hepatitis C
    110292183 (Pik3cd)
   05171 Coronavirus disease - COVID-19
    110292183 (Pik3cd)
   05164 Influenza A
    110292183 (Pik3cd)
   05162 Measles
    110292183 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    110292183 (Pik3cd)
   05163 Human cytomegalovirus infection
    110292183 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292183 (Pik3cd)
   05169 Epstein-Barr virus infection
    110292183 (Pik3cd)
   05165 Human papillomavirus infection
    110292183 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110292183 (Pik3cd)
   05142 Chagas disease
    110292183 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110292183 (Pik3cd)
   01524 Platinum drug resistance
    110292183 (Pik3cd)
   01522 Endocrine resistance
    110292183 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110292183 (Pik3cd)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110292183 (Pik3cd)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110292183 (Pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 110292183
NCBI-ProteinID: XP_021014979
Ensembl: MGP_CAROLIEiJ_G0026820
UniProt: A0A6P5PID9
LinkDB
Position
4
AA seq 1048 aa
MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRA
GLLRVCNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLVEQPEEYA
LQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHFSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMKLIVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRGNPNTESAAALVIYLPEVAP
HPVYFPALEKILELGRHGERGHITEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNKHEDVAQLSQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAI
KSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHV
PSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHM
CMRQETYMEALSHLQSPLDPSTLLEEVCSVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGI
IFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIAN
IQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHS
DNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERF
RGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFR
VKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3147 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaggagagccagagcgtg
gttgttgacttcttgctgcccacaggagtctacttgaacttccccgtgtcccgcaatgcc
aacctcagcaccatcaagcaggtgctgtggcaccgtgcacagtacgagccactcttccac
atgctcagcgaccccgaggcctatgtgttcacctgtgtgaaccagacggcggagcagcag
gagttggaggatgagcagcggaggctgtgcgacatccagcccttcctgcccgtgctgcgc
ctcgtggcccgagagggggaccgcgtgaagaagctcattaactctcagatcagcctcctc
atcggcaaaggtctccatgagtttgattccctgcgggacccggaagtaaacgacttccgc
accaagatgcgccagttttgtgaagaggctgcggctcaccgccagcagctgggctgggtg
gaatggctgcagtacagcttccccctgcagctggagccctcagcgaggggttggcgggcc
ggcttactgcgtgtctgcaaccgagccctgctggtcaacgtgaagttcgagggcagtgag
gagagcttcaccttccaggtatccaccaaggacatgcccctggcactgatggcctgtgcc
ctccgaaaaaaggccacagtgttcaggcagcctctggtggagcagcctgaggaatacgcc
ctgcaggtgaacgggaggcacgaatacctctatggcaactacccgctctgccactttcag
tacatctgcagctgcctacacagcgggctgactccccatctgaccatggtccacttctcc
tccatccttgctatgcgggatgagcagagcaatcctgccccccaagtgcagaaaccacgt
gccaaacctcccccgatccctgccaagaagccctcctctgtgtccctgtggtccctggaa
cagccattctccattgagctgatcgagggccgaaaagtgaatgcggacgagcggatgaag
ctgattgttcaggctgggctcttccatggcaatgagatgctgtgcaagactgtgtcaagc
tcggaggtgaatgtatgctcagagcccgtgtggaagcagcgactggagttcgatatcagc
gtctgtgacctcccgcgcatggctcgactctgctttgctctctatgccgtcgtggagaag
gctaagaaggcgcggtccacaaaaaagaagtctaagaaggcggactgcccgatcgcttgg
gccaacctcatgctattcgactacaaagatcagctcaagactggggagcgctgcctctac
atgtggccctctgtcccagatgagaagggagagctgctgaatcctgcgggtacagtacgc
gggaaccccaacacagagagtgccgctgccctggtcatctacctgcctgaggtggccccc
caccctgtgtacttccctgctctggagaagatcctggagctggggcgtcacggggagcgt
gggcacatcacggaggaggagcagctgcagctgcgggagatcctggaacggcggggatcc
ggggaactgtacgaacatgagaaggacctggtgtggaagatgcgccacgaagtccaggag
catttcccagaggcgctggcccgcctgctgctggtcaccaagtggaataaacatgaggac
gtggcccagctgtcccagatgctctatttgctgtgctcctggcccgagctgcctgtgctg
agcgccctggaacttctggactttagctttcccgactgctacgtgggctccttcgccatc
aagtcccttcggaagctgacggacgatgagctcttccagtaccttctgcagctggtgcaa
gtgctcaaatatgagtcctacctggactgcgagttgaccaaattcttgctgggccgagcc
ctggctaaccgcaagatcggacacttcctgttctggcacctccgctctgagatgcacgta
ccatcagtggctctgcggtttggtctcatcatggaagcctactgcagaggcagcacccac
cacatgaaggtgctgatgaagcagggggaagcactgagcaagcttaaggcactgaatgac
tttgtgaaggtgagctcccagaagaccaccaagccccaaaccaaagagatgatgcatatg
tgcatgcgccaggagacctacatggaggccctgtcccacctgcagtctccactcgatccc
agcaccctgctggaggaagtctgcagtgtggagcagtgcaccttcatggactccaaaatg
aagcccctgtggatcatgtacagcagcgaggaggcgggcagtgctggcaacgtgggcatc
atctttaagaacggggatgacctccgccaggacatgctgactctgcagatgatccagctc
atggacgtcctgtggaagcaggagggcctggacctgaggatgacgccctacggctgcctc
cccaccggggaccgcacaggtctcatcgaggtggtcctccactcggacaccatcgccaac
atccagctgaacaaaagcaacatggcggccacagctgccttcaacaaggacgccctgctc
aactggctcaagtccaagaaccctggggaggccctggatcgggccattgaagaattcacc
ctctcctgtgctggctactgtgtggccacatatgtgctgggcatcggtgaccggcacagc
gacaacatcatgatcagagagagtgggcagctcttccacattgattttggccactttctg
gggaacttcaagaccaagtttggaatcaaccgagagcgcgtccccttcattctcacctac
gactttgtccacgtgatccagcaggggaagactaacaacagtgagaagtttgaaaggttc
cgcggctactgtgaacgagcctacaccatcctgcggcgccacgggctgcttttcctccat
ctcttcgccctgatgcgggctgcaggtctgcctgagcttagctgctccaaagacatccag
tatctcaaggactctctggcactggggaagacggaggaagaggcgctaaagcacttccgg
gtgaagttcaacgaagctctccgagaaagctggaaaaccaaagtcaactggttggcgcac
aatgtgtccaaggataacagacagtag

KEGG   Mus caroli (Ryukyu mouse): 110301355
Entry
110301355         CDS       T05910                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00562  Inositol phosphate metabolism
mcal01100  Metabolic pathways
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal01524  Platinum drug resistance
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04070  Phosphatidylinositol signaling system
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04210  Apoptosis
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04725  Cholinergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04810  Regulation of actin cytoskeleton
mcal04910  Insulin signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04923  Regulation of lipolysis in adipocytes
mcal04926  Relaxin signaling pathway
mcal04929  GnRH secretion
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal04960  Aldosterone-regulated sodium reabsorption
mcal04973  Carbohydrate digestion and absorption
mcal05010  Alzheimer disease
mcal05017  Spinocerebellar ataxia
mcal05020  Prion disease
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05142  Chagas disease
mcal05146  Amoebiasis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110301355 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110301355 (Pik3cb)
   04014 Ras signaling pathway
    110301355 (Pik3cb)
   04015 Rap1 signaling pathway
    110301355 (Pik3cb)
   04370 VEGF signaling pathway
    110301355 (Pik3cb)
   04630 JAK-STAT signaling pathway
    110301355 (Pik3cb)
   04668 TNF signaling pathway
    110301355 (Pik3cb)
   04066 HIF-1 signaling pathway
    110301355 (Pik3cb)
   04068 FoxO signaling pathway
    110301355 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    110301355 (Pik3cb)
   04072 Phospholipase D signaling pathway
    110301355 (Pik3cb)
   04071 Sphingolipid signaling pathway
    110301355 (Pik3cb)
   04024 cAMP signaling pathway
    110301355 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    110301355 (Pik3cb)
   04152 AMPK signaling pathway
    110301355 (Pik3cb)
   04150 mTOR signaling pathway
    110301355 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110301355 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    110301355 (Pik3cb)
   04218 Cellular senescence
    110301355 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110301355 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    110301355 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110301355 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110301355 (Pik3cb)
   04613 Neutrophil extracellular trap formation
    110301355 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    110301355 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    110301355 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    110301355 (Pik3cb)
   04660 T cell receptor signaling pathway
    110301355 (Pik3cb)
   04662 B cell receptor signaling pathway
    110301355 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    110301355 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    110301355 (Pik3cb)
   04670 Leukocyte transendothelial migration
    110301355 (Pik3cb)
   04062 Chemokine signaling pathway
    110301355 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110301355 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    110301355 (Pik3cb)
   04929 GnRH secretion
    110301355 (Pik3cb)
   04915 Estrogen signaling pathway
    110301355 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    110301355 (Pik3cb)
   04917 Prolactin signaling pathway
    110301355 (Pik3cb)
   04926 Relaxin signaling pathway
    110301355 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    110301355 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    110301355 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110301355 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110301355 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    110301355 (Pik3cb)
   04722 Neurotrophin signaling pathway
    110301355 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110301355 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    110301355 (Pik3cb)
   04380 Osteoclast differentiation
    110301355 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    110301355 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    110301355 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110301355 (Pik3cb)
   05206 MicroRNAs in cancer
    110301355 (Pik3cb)
   05205 Proteoglycans in cancer
    110301355 (Pik3cb)
   05203 Viral carcinogenesis
    110301355 (Pik3cb)
   05230 Central carbon metabolism in cancer
    110301355 (Pik3cb)
   05231 Choline metabolism in cancer
    110301355 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110301355 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110301355 (Pik3cb)
   05212 Pancreatic cancer
    110301355 (Pik3cb)
   05225 Hepatocellular carcinoma
    110301355 (Pik3cb)
   05226 Gastric cancer
    110301355 (Pik3cb)
   05214 Glioma
    110301355 (Pik3cb)
   05221 Acute myeloid leukemia
    110301355 (Pik3cb)
   05220 Chronic myeloid leukemia
    110301355 (Pik3cb)
   05218 Melanoma
    110301355 (Pik3cb)
   05211 Renal cell carcinoma
    110301355 (Pik3cb)
   05215 Prostate cancer
    110301355 (Pik3cb)
   05213 Endometrial cancer
    110301355 (Pik3cb)
   05224 Breast cancer
    110301355 (Pik3cb)
   05222 Small cell lung cancer
    110301355 (Pik3cb)
   05223 Non-small cell lung cancer
    110301355 (Pik3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110301355 (Pik3cb)
   05017 Spinocerebellar ataxia
    110301355 (Pik3cb)
   05020 Prion disease
    110301355 (Pik3cb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110301355 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110301355 (Pik3cb)
   04932 Non-alcoholic fatty liver disease
    110301355 (Pik3cb)
   04931 Insulin resistance
    110301355 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110301355 (Pik3cb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110301355 (Pik3cb)
   05135 Yersinia infection
    110301355 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    110301355 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110301355 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    110301355 (Pik3cb)
   05161 Hepatitis B
    110301355 (Pik3cb)
   05160 Hepatitis C
    110301355 (Pik3cb)
   05171 Coronavirus disease - COVID-19
    110301355 (Pik3cb)
   05164 Influenza A
    110301355 (Pik3cb)
   05162 Measles
    110301355 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    110301355 (Pik3cb)
   05163 Human cytomegalovirus infection
    110301355 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110301355 (Pik3cb)
   05169 Epstein-Barr virus infection
    110301355 (Pik3cb)
   05165 Human papillomavirus infection
    110301355 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110301355 (Pik3cb)
   05142 Chagas disease
    110301355 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110301355 (Pik3cb)
   01524 Platinum drug resistance
    110301355 (Pik3cb)
   01522 Endocrine resistance
    110301355 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110301355 (Pik3cb)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110301355 (Pik3cb)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110301355 (Pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 110301355
NCBI-ProteinID: XP_021027466
Ensembl: MGP_CAROLIEiJ_G0032558
UniProt: A0A6P7RCB3
LinkDB
Position
9
AA seq 1064 aa
MPPAMADNLDIWAVDSQIASDGTISVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNY
PMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAEKLDSKI
GVLIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWIDWLKHTYPPEHEPSVLE
NLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIRGKEDEASPCDY
VLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINR
NSSNLPLPLPPKKTRVISHIWDNNNPFQIILVKGNKLNTEETVKVHVRAGLFHGTELLCK
TVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQ
TIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVTLHSWSSFPDELEEMLNPMGTVQTNPYAE
NATALHIKFPENKKQPYYYPPFDKIIEKAAELASGDSANVSSRGGKKFLAVLKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALD
NRRIGQFLFWHLRSEVHTPAVSIQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLI
KLNAVKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPL
WLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
RSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA
GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIH
VIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKD
SLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcctcctgctatggcagacaaccttgacatctgggcagtggactcacagattgcatcc
gatggcaccatatccgtcgatttccttctgcccacagggatttatatccagttggaagta
cctcgggaagctaccatttcttatattaaacagatgttatggaagcaagttcacaactac
ccgatgtttaacctcctcatggacattgactcgtatatgtttgcatgtgtgaatcaaact
gctgtatatgaggagctggaagacgaaacacgaagactttgtgatgtcagaccttttctt
ccagttctcaaactagtgactagaagctgtgaccccgcagaaaaattggactcaaaaatt
ggagttcttataggaaaaggtcttcatgagtttgatgccttgaaggatcccgaagtaaat
gaatttagaagaaaaatgcgcaaattcagtgaggccaagattcagtctctggtggggttg
tcttggatcgactggctaaagcacacgtatccgcctgagcacgagccgtccgtcctggag
aacttggaagataaactttatggaggaaagctggttgtggctgtgcactttgaaaatagc
caggatgtatttagttttcaagtgtctcccaatttgaatcctataaaaataaatgaattg
gcaattcagaaacgcctcactattcgtgggaaggaagatgaagctagcccctgtgactat
gtgttacaggtcagtgggagagtggagtatgtgtttggcgatcatccactaattcagttt
cagtacatccggaattgtgtgatgaatagaaccctgccccacttcatccttgtggaatgt
tgtaagatcaagaaaatgtatgaacaagaaatgattgccatagaggctgccatcaaccga
aactcatccaaccttcctctccctttaccaccaaagaaaacacgagttatttctcatatc
tgggacaacaacaaccctttccaaattatcttggtaaaaggaaataagcttaatacagaa
gaaactgtgaaagttcatgtccgagctgggctttttcacggaaccgagctcctgtgtaaa
actgtcgtaagctcagagatatcaggaaagaacgaccatatttggaatgaacaactggaa
tttgatattaatatttgcgacttaccaagaatggctcgattatgttttgctgtttatgca
gttttggataaagtaaaaacgaagaaatcaacaaaaactattaatccctctaagtatcaa
accatcaggaaagccgggaaagtgcattatcctgtcgcgtgggtaaataccatggttttt
gacttcaaaggacagctgaggtctggagacgtcacattgcatagctggtcttcatttcct
gatgagctggaagaaatgctgaatcccatggggactgtgcagacgaacccatatgctgag
aatgctactgccttgcatattaagttcccagagaataagaagcagccttattattatccc
cccttcgataagatcattgagaaggcagctgagcttgccagcggagacagtgctaatgtg
tctagtcgtggtgggaaaaaatttcttgctgtactgaaagaaatcttggaccgggacccc
ctgtctcagctgtgtgagaacgaaatggaccttatttggactctacggcaagactgccga
gaaaatttccctcagtcactgccaaaactactcctgtcaatcaaatggaataaacttgaa
gatgttgctcagcttcaggcgctcctgcagatttggcccaaactgccccccagggaagcc
ctggaactcctggatttcaactatccagaccagtatgtccgggaatacgctgtaggctgc
cttcggcagatgagtgatgaagaactctctcagtatcttttacaattggtgcaagttttg
aaatatgagccttttctcgattgtgccctctccagattcctattagaaagagcacttgat
aatcggaggattgggcagtttctgttttggcatcttaggtcagaggtacacactcctgct
gtgtccatacagtttggtgtcatcctggaagcatactgtcgaggaagcgtggggcacatg
aaagtgctttccaaacaggtggaagcactcaataagttaaaaactttaaatagcttaatc
aaactgaatgcggtgaagctgaacagagctaaaggaaaggaggccatgcacacgtgcctg
aaacagagtgcctaccgggaggcgctctctgacctgcagtcgccgctgaacccctgcgtc
atcctctcagagctctatgttgaaaagtgcaaatacatggactccaagatgaagcccctg
tggctggtctacagcagcagagcctttggagaggactcggttggagtgatttttaaaaat
ggtgacgatttgcggcaggacatgctgacactgcagatgctgcgcctgatggatctgctg
tggaaagaagctggcttggacctgcggatgctcccctatggctgcttagcaacaggagat
cgctctggcctcattgaggttgtgagcacctctgagacaatcgctgacattcagctgaac
agtagtaacgtggctgccacggcagccttcaacaaagatgcactcctgaactggctcaag
gagtacaactctggggatgacctggaccgagcgattgaggagtttaccttgtcctgtgct
ggctactgtgtagcctcttatgtcctcggcattggtgacaggcacagtgacaacatcatg
gtgaagaaaaccggccagctcttccacatagattttgggcatattcttggaaatttcaaa
tctaaatttggcattaaaagggagcgagtaccttttattcttacttacgacttcattcat
gtcattcaacaaggaaaaacggggaacactgaaaaatttggcaggttccgccagtgctgt
gaagatgcgtacctgattttacggcggcatgggaatctcttcatcactctgtttgccctg
atgttgactgcagggctgcctgagctcacatcggtcaaagatatacagtatcttaaggac
tcgcttgccttagggaagagcgaggaagaagcactgaagcagttcaagcagaagtttgac
gaggccctcagggaaagctggactactaaagtgaactggatggctcacacagtgcggaaa
gactacaggtcctag

DBGET integrated database retrieval system