KEGG   Mus caroli (Ryukyu mouse): 110290800
Entry
110290800         CDS       T05910                                 

Gene name
Fh
Definition
(RefSeq) fumarate hydratase, mitochondrial
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00020  Citrate cycle (TCA cycle)
mcal00620  Pyruvate metabolism
mcal01100  Metabolic pathways
mcal01200  Carbon metabolism
mcal04934  Cushing syndrome
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Module
mcal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110290800 (Fh)
   00620 Pyruvate metabolism
    110290800 (Fh)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110290800 (Fh)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110290800 (Fh)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110290800 (Fh)
Enzymes [BR:mcal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     110290800 (Fh)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-GeneID: 110290800
NCBI-ProteinID: XP_021013229
Ensembl: MGP_CAROLIEiJ_G0014943
UniProt: A0A6P5PD65
LinkDB
Position
1
AA seq 507 aa
MYRALRLLARSRRLLRVPSAGAAVSGEATTLPRCAPNVARMASQNSFRVEFDTFGELKVP
TDKYYGAQTVRSTMNFKIGGATERMPIPVIQAFGILKRAAAEVNQEYGLDPKIASAIMKA
ADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNK
SQSSNDTFPTAMHIAAAVEVHKVLLPGLQKLHDALSAKSKEFAQVIKIGRTHTQDAVPLT
LGQEFSGYVQQVQYAMVRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGL
PFVTAPNKFEALAAHDALVELSGAMNTAACSLMKIANDIRFLGSGPRSGLGELILPENEP
GSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLL
GDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLK
ETAIELGYLTAEQFDEWVKPKDMLGPK
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgtaccgcgcactccgtctcctcgcgcgctcgcgtcgtctcctgcgtgttccgtccgcc
ggtgctgcagtgtctggggaagcgaccaccctcccgcggtgtgctccgaacgtcgcgcga
atggcaagccaaaattccttccgtgtagagttcgacacctttggtgaattgaaggttcca
accgataagtattatggtgctcagaccgtaagatctacgatgaactttaagattggaggt
gctacggaacgtatgccaatcccagtcattcaagctttcggcatcttgaagcgagctgct
gctgaagtaaaccaggagtatggtctcgatccaaagattgccagtgcaatcatgaaggcc
gcagatgaggtagctgaaggtaaattaaatgatcactttcctctggtggtttggcagact
ggatcaggaacccagacaaacatgaatgtaaatgaagtcattagcaacagagcaattgaa
atgttaggaggggaacttggcagcaagaagcctgtgcaccccaatgatcatgttaacaaa
agccagagctcgaatgacacctttcccacagcaatgcacattgctgctgcagtggaagtt
cacaaggtcctgttgccagggttacagaagctccatgatgctctcagtgcaaaatccaaa
gagtttgcgcaggtcatcaaaattgggcgaactcacacgcaggacgctgtccctcttact
cttggacaggaattcagtggttacgttcagcaagtccagtatgcgatggtgagaataaaa
gccgccatgccaagaatctacgagctcgctgctggaggcactgctgtggggacggggtta
aacaccaggatcggcttcgcagaaaaggtggccgcaaaagtagcagcactcacaggtttg
ccttttgtcactgccccgaataagtttgaagctctggctgctcatgatgctctggttgag
cttagtggagccatgaacactgccgcctgcagtctaatgaagatagcaaatgatattcgc
ttcctgggttctggtcctcggtcaggtttgggagagctgatcttgcctgaaaacgagcca
gggagcagcatcatgccaggaaaggtgaaccctactcagtgtgaagcgatgaccatggtt
gcagcccaagtcatggggaatcacgttgctgttaccgttggaggcagcaatggacatttt
gaactgaatgtgtttaaaccaatgatgattaagaatgtgttgcactcagccaggctactg
ggagatgcttcagtgtcctttacagagaactgtgtggtcgggatccaggccaacacagag
aggatcaacaagctaatgaatgagtctttaatgttggtcacagctcttaatccacatata
gggtatgacaaagcagcaaagattgccaagaccgcacacaagaacggatcaaccttaaag
gaaacggctattgaacttggctatctcacagcagagcagtttgatgagtgggtgaaaccc
aaggacatgctgggtccaaagtga

DBGET integrated database retrieval system