KEGG   Mus caroli (Ryukyu mouse): 110290944
Entry
110290944         CDS       T05910                                 

Gene name
Prkci
Definition
(RefSeq) protein kinase C iota type
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04144  Endocytosis
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04611  Platelet activation
mcal04910  Insulin signaling pathway
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110290944 (Prkci)
   04390 Hippo signaling pathway
    110290944 (Prkci)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110290944 (Prkci)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110290944 (Prkci)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110290944 (Prkci)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110290944 (Prkci)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110290944 (Prkci)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110290944 (Prkci)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110290944 (Prkci)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110290944 (Prkci)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like APH C1_2 Kdo
Other DBs
NCBI-GeneID: 110290944
NCBI-ProteinID: XP_021013522
Ensembl: MGP_CAROLIEiJ_G0024909
UniProt: A0A6P5P9C9
LinkDB
Position
3
AA seq 595 aa
MPTQRDSSTMSHTVACGGGGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSF
DNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPPEPMMPMDQTMHPDHTQTVIPYNPSSHESLDQVGEEKEAMNTRE
SGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQT
EKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAE
ISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIA
PEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRI
PRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKP
NISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgccgacccagagggacagcagcaccatgtcccacacggtcgcgtgcggcggcggcggg
gaccattcccaccaggtccgggtgaaagcctactaccgcggggatattatgataacacac
tttgagccttccatctcctttgagggactttgcagtgaggttcgagatatgtgttctttt
gacaatgagcagccgttcaccatgaaatggatagatgaggaaggagacccgtgtacggtg
tcttctcagttggagttagaagaggctttcaggctgtacgagctgaacaaggattctgaa
ctcttgatccatgtatttccatgtgtaccagagcgtcctggaatgccttgcccaggggaa
gacaagtccatttaccggagaggggcacgccggtggagaaagctgtattgtgcaaatggc
cacacttttcaagccaaacgtttcaacaggcgcgcccactgtgccatctgcacagacaga
atctggggccttggacgacaaggatacaagtgcatcaactgcaaactgctggttcataag
aagtgccacaagctggtcacaattgagtgtgggcggcactctctgccaccggaacccatg
atgccaatggaccagaccatgcatccagaccacacacagacagtaattccatataatcct
tcaagtcatgagagtttggaccaagttggtgaagaaaaggaggcaatgaataccagggag
agtggtaaagcgtcgtcgagtctaggtctgcaggatttcgatttgcttcgagttataggg
agaggaagttacgccaaagtactgttggttcggttaaaaaaaacagatcgcatttatgca
atgaaagttgtgaagaaagagctcgtcaatgacgatgaggatattgattgggtgcagaca
gagaagcatgtgtttgagcaggcgtccaatcacccttttcttgtcgggctgcattcttgc
ttccagacagaaagcaggttgttttttgtcatagaatatgtaaatggaggggacctcatg
tttcatatgcagcgacagagaaaacttcctgaagagcatgccaggttttactctgcagaa
atcagtctagcactgaattatcttcatgagcgagggataatttatagagatttgaagttg
gacaatgtactgctggactctgaaggacacattaaactcactgactacggcatgtgtaag
gaaggattgcggcctggagatacaaccagcactttctgcggcactcccaattacattgct
cctgagatcttaagaggagaagattatggcttcagcgttgactggtgggctcttggagtg
cttatgtttgagatgatggcaggaaggtctccatttgatatcgttgggagctctgacaat
cctgaccaaaacacagaggattatctattccaagtcattttggaaaagcagattcgcatc
ccacgttctctgtctgtaaaagcagcgagtgtgctgaagagttttctcaacaaggaccca
aaggaacgattgggttgtcaccctcaaactggatttgctgacattcaaggacatccattc
ttcagaaatgtggactgggacatgatggagcaaaagcaggtggttccaccctttaaacca
aacatttctggagaatttggtttggataatttcgattcccagtttactaatgaaccagtc
cagctcactccagatgatgatgacattgtaaggaagatcgatcagtctgaatttgaaggt
ttcgagtatatcaaccccctcttgatgtctgctgaagagtgtgtctga

KEGG   Mus caroli (Ryukyu mouse): 110292460
Entry
110292460         CDS       T05910                                 

Gene name
Prkcz
Definition
(RefSeq) protein kinase C zeta type isoform X1
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04144  Endocytosis
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal04611  Platelet activation
mcal04910  Insulin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05165  Human papillomavirus infection
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110292460 (Prkcz)
   04390 Hippo signaling pathway
    110292460 (Prkcz)
   04071 Sphingolipid signaling pathway
    110292460 (Prkcz)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110292460 (Prkcz)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110292460 (Prkcz)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110292460 (Prkcz)
   04062 Chemokine signaling pathway
    110292460 (Prkcz)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110292460 (Prkcz)
   04926 Relaxin signaling pathway
    110292460 (Prkcz)
  09158 Development and regeneration
   04360 Axon guidance
    110292460 (Prkcz)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110292460 (Prkcz)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110292460 (Prkcz)
   04931 Insulin resistance
    110292460 (Prkcz)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110292460 (Prkcz)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110292460 (Prkcz)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110292460 (Prkcz)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110292460 (Prkcz)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110292460 (Prkcz)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like C1_2 APH Kdo DZR
Other DBs
NCBI-GeneID: 110292460
NCBI-ProteinID: XP_021015428
Ensembl: MGP_CAROLIEiJ_G0026887
UniProt: A0A6P5PI29
LinkDB
Position
4
AA seq 594 aa
MPSRMDPKMDQSGGRGRVRLKAHYGGDILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTL
KWVDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRG
ARRWRKLYRANGHLFQAKRFNRGAYCGQCSERIWGLSRQGYRCINCKLLVHKRCHVLVPL
TCRRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGV
DGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQ
TEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAA
EICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYI
APEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIP
RFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQ
ITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgcccagcaggatggaccccaagatggaccagagcggcggccgcggccgcgtccgtctg
aaggcgcactacggcggggacatcctgattaccagcgtggatgccatgacaacattcaag
gacctctgtgaggaagtgcgagacatgtgtggcctgcaccagcagcacccactcaccctc
aagtgggtggacagtgaaggtgacccttgtactgtgtcctcacagatggagttggaggag
gccttccgcctggcctgtcagggcagggacgaagtgctcatcattcatgttttcccgagc
atcccagaacagccgggcatgccttgtcctggagaagacaagtccatctaccgccgtgga
gccagaagatggaggaagctgtaccgagccaacggccacctcttccaagccaagcgcttt
aacaggggagcgtactgcggccagtgcagcgaaaggatatggggtctctcgaggcagggc
tacaggtgcatcaactgcaagctgctggtccataaacgctgccacgtcctcgtcccgctg
acctgcaggaggcatatggattctgtcatgccttcccaagagcctccagtagatgacaag
aacgatggtgtagaccttccttcagaagaaactgatggaattgcttatatttcttcatct
cggaaacatgataatatcaaagatgattctgaggaccttaagcctgtcatcgatggggtg
gatgggatcaaaatctctcaggggctggggctgcaagacttcgacctcatcagagtcatc
gggcgtggaagctatgccaaggtcctcctggtgcggttgaagaaaaatgaccagatttac
gccatgaaggtggtaaagaaggagcttgtccatgacgacgaggatatcgactgggtgcag
acagagaagcatgtgtttgagcaggcgtccagcaaccccttcctggttggcttacactcc
tgcttccagacaacgagccggttgtttctggtcatcgagtatgtcaatgggggggacctc
atgttccacatgcagaggcagaggaagcttccagaggaacatgccaggttctatgctgct
gagatctgtatcgctctcaacttcctgcacgagagggggatcatctaccgggacctaaaa
ctggacaacgtcctcctcgatgccgacggacacattaagctgacggactacggcatgtgc
aaggaaggtctaggccccggtgatacaacaagcactttttgtggaaccccgaactatatc
gcccccgaaatcctgcgaggagaagagtacgggttcagcgtggactggtgggcactgggt
gtccttatgtttgagatgatggctgggcgctccccctttgacatcatcacggacaaccct
gacatgaacactgaagactaccttttccaagttatcctggaaaagccaattcggattccc
cgtttcctgtctgtcaaggcctcacacgtcttgaaaggatttttaaataaggatcccaaa
gagaggcttggctgccggccacagactgggttttccgacatcaagtcccacgctttcttc
cgcagcatagactgggacctgctggaaaagaagcagaccctgcctcccttccagccccag
atcacagatgactatggcctggacaactttgacacgcagttcaccagcgagcctgtacag
ctgaccccagatgatgaggacgtcataaagaggatcgaccagtccgagtttgaaggcttt
gagtacatcaacccgcttctgctgtctgctgaggagtccgtgtga

DBGET integrated database retrieval system