KEGG   Mus caroli (Ryukyu mouse): 110291005
Entry
110291005         CDS       T05910                                 

Gene name
Egf
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04020  Calcium signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04510  Focal adhesion
mcal04540  Gap junction
mcal04630  JAK-STAT signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal05160  Hepatitis C
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05213  Endometrial cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05218  Melanoma
mcal05219  Bladder cancer
mcal05223  Non-small cell lung cancer
mcal05224  Breast cancer
mcal05226  Gastric cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110291005 (Egf)
   04012 ErbB signaling pathway
    110291005 (Egf)
   04014 Ras signaling pathway
    110291005 (Egf)
   04015 Rap1 signaling pathway
    110291005 (Egf)
   04630 JAK-STAT signaling pathway
    110291005 (Egf)
   04066 HIF-1 signaling pathway
    110291005 (Egf)
   04068 FoxO signaling pathway
    110291005 (Egf)
   04020 Calcium signaling pathway
    110291005 (Egf)
   04072 Phospholipase D signaling pathway
    110291005 (Egf)
   04151 PI3K-Akt signaling pathway
    110291005 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110291005 (Egf)
   04540 Gap junction
    110291005 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110291005 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291005 (Egf)
   05231 Choline metabolism in cancer
    110291005 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110291005 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110291005 (Egf)
   05212 Pancreatic cancer
    110291005 (Egf)
   05226 Gastric cancer
    110291005 (Egf)
   05214 Glioma
    110291005 (Egf)
   05218 Melanoma
    110291005 (Egf)
   05219 Bladder cancer
    110291005 (Egf)
   05215 Prostate cancer
    110291005 (Egf)
   05213 Endometrial cancer
    110291005 (Egf)
   05224 Breast cancer
    110291005 (Egf)
   05223 Non-small cell lung cancer
    110291005 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110291005 (Egf)
   05165 Human papillomavirus infection
    110291005 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110291005 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110291005 (Egf)
Cytokines and growth factors [BR:mcal04052]
 Growth factors
  Growth factors (RTK binding)
   110291005 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050 SGL EGF_MSP1_1 hEGF Tr-sialidase_C
Other DBs
NCBI-GeneID: 110291005
NCBI-ProteinID: XP_021013600
Ensembl: MGP_CAROLIEiJ_G0025624
UniProt: A0A6P5PFK3
LinkDB
Position
3
AA seq 1208 aa
MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSGTCAGPAPFLVFSQGKSI
SRIDPDGTNHQQLVVDAGISVDMDIHYEKQRIYWVDVERQLLLRVFLNGTGLEKVCNVEQ
KMSGLAINWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMFWSS
EVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYDGGS
VRLIRHQAWHSLSSMAFFGDRIFYSVLKNKAIWIANKHTGKDTVRINLHPSFVTPGKLMV
VHPHAQPRTENGGKDPDPERLKRRRYSLCEPDPKSHSCTCAEGYTLTRDGKYCEDVNECA
SQNHGCTLGCENTPGSYHCTCPAGFVLLPDGKQCHELVSCPGNVSKCSHGCVLTSDGPRC
ICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDGKSCAASGP
QPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALKWIERAKM
DGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIRENISRPR
GIAVHPKARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPNGITIDYLTDTLYWCDT
KRSVIEMANLDGSKRRRLTQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRTGQNRVRL
QGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTAQCLCREGFVKAWDGKMCL
PQDYPIQSGDNADLSKEVISLNNSTKAEEPDDDGTESSTLVAEIMVSGMNYEDDCGPGGC
GSHAHCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPTTSSRCINTEGGYVCRCS
EGYEGDGISCFDIDECQQGAHNCGENAACTNTEGGYNCTCAGRPSSPSRSCPDSTAPSLL
GEDGHHLDRNSYPGCPSSYDGYCLNGGVCIHIESLDSYACNCIVGYSGDRCQTRDLRWWE
LRHAGYGQKHDIMVVAVCMVALVLLLLLGMWGTYYYRTQKQLSKSPKNPCDEPSGSVSSS
GPDSSSSSGAGVASCPQPWFVVLEEHQDPKNGSLPADGTNGAVVDAGLSPSLRLGSVHLT
SWRQKPHIDGMGTGIPPSSDRGPQEMEGNSHLPSYRPVGPEKLHSLQSANGSCHQRAPDL
PGQTEPVQ
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgccctggggccgaaggccaacctggctgttgctcgccttcctgctggtgtttttaaag
attagcatactcagcgtcacagcatggcagaccgggaactgtcagccaggtcctctggag
agaagcgggacttgtgccggtcctgcccccttcctagttttctcccaaggaaagagcatc
tctcggattgacccagatggaacaaatcaccaacaattggtggtggatgctggcatctca
gtggacatggatattcattatgaaaaacagagaatctattgggtagatgtagaaagacaa
cttttgctaagagttttccttaacgggacaggactagagaaagtgtgcaatgtagagcag
aagatgtctgggctggccataaactggatagatgatgaagttctctgggtagaccaacag
aacggagtcatcaccgtaacagatatgacagggaaaaattcccgagttcttctaagttcc
ttaaagcacccgtcaaatatagcagtggatccaatagagaggttgatgttttggtcttca
gaggtgaccggcagccttcacagagcacacctcaaaggtgttgatgtaaaaacactgctg
gagacaggggggatatcagtgctgactcttgatgtcctggacaaacggctcttctgggtt
caggacagtggtgaaggaagccacgcttacattcattcctgtgattacgatggtggctcc
gtccgtcttatcagacatcaagcatggcacagtttgtcttcaatggccttttttggtgat
cggatcttctactcagtgttgaaaaacaaggcgatttggatagccaacaaacacacaggg
aaggacacggttaggattaacctccatccatcctttgtgacacctggaaaactgatggta
gtacaccctcatgcacagcccaggacagagaacggtggtaaggatcctgaccccgaacgt
ctcaaacgtcgccgctacagtctctgtgagccagaccccaagtcccactcgtgcacttgc
gctgagggctacacgttaacccgagacgggaagtactgcgaagatgtcaatgaatgtgcc
tctcagaatcacggctgtactcttgggtgtgaaaacacccctggatcctatcactgcaca
tgccccgcaggatttgttctgcttcctgatgggaaacaatgtcacgaactcgtttcctgc
ccaggcaacgtatcaaagtgcagtcatggctgtgtcctgacatcagatggtccccggtgc
atctgtcctgcaggttcagtgcttgggagagatgggaagacttgcactggttgttcatcg
cctgacaatggtggatgcagccagatctgtcttcctctcaggccaggatcttgggaatgt
gattgctttcctgggtatgacctacagtcagacggaaagagctgtgcagcttcaggacca
cagccacttttactgtttgcaaattcccaggacatccgacacatgcattttgatggaaca
gactacaaagttctgctcagccggcagatgggaatggtttttgccttggattatgaccct
gtggaaagcaagatatattttgcacagacagccctgaagtggatagagagggctaagatg
gatgggtcccagcgagaaagactgatcacagaaggagtagacacgcttgaaggtcttgcc
ctggactggattggccggagaatctactggacagacagtgggaagtctgttgttggaggg
agtgatctgagcgggaagcatcatcgaataatcatccgagagaacatctcgaggccacga
ggaatcgctgtgcatccgaaggccaggagactcttctggacggacgtagggatgtctcca
cggattgaaagcgcttcccttcaaggttccgaccgggtgctgatagccagctctaatcta
ctggaacccaatggaatcacgattgactacttaacagacactttgtactggtgtgacacc
aagaggtctgtgattgaaatggccaatctggatggctccaaacgccgaaggcttacccag
aacgatgtaggtcaccccttctctctagccgtgtttgaggatcacctgtgggtctcggat
tgggctatcccatcggtaataagggtgaacaagaggactggccaaaacagggtacgtctt
caaggcagcatgctgaagccctcgtcactggttgtggttcatccattggcaaaaccaggt
gcagatccctgcttatacaggaatggaggctgtgaacacatctgccaagagagcctgggc
acggctcagtgtttgtgtcgtgaaggttttgtgaaggcctgggatgggaaaatgtgcctc
cctcaggattatccaatacagtcaggtgacaatgctgatcttagtaaagaggtgatatca
ctgaacaactccactaaggctgaagaaccagacgatgatgggacagaatcttccacacta
gtggctgaaatcatggtgtcagggatgaactatgaagatgactgtggtcccggggggtgt
ggcagccatgctcactgcgtttcagatggagagactgctgagtgtcagtgtctgaaagga
tttgccagggatggaaacctgtgttctgatatagatgagtgtgtgctggctagatcggac
tgtcccaccacctcgtccaggtgcatcaacactgaaggtggctacgtctgcagatgctca
gaaggctacgaaggagacgggatctcctgtttcgatattgacgagtgccagcagggggcg
cacaactgcggtgagaatgccgcctgcaccaacacggagggaggctacaactgcacctgc
gcaggccgcccatcctcgcccagtcggagttgccctgactctaccgcaccctctctcctt
ggggaagatggccaccatttggaccgaaatagttacccaggatgcccatcctcatatgat
ggatactgcctcaatggtggcgtgtgcatacatattgaatcactggacagctacgcatgc
aactgtattgttggctattctggggatcgatgtcagactcgagacttacgatggtgggag
ctgcgtcatgctggctacgggcagaagcatgacatcatggtggtggctgtctgcatggtg
gcgctggtcctgctgctcctcttggggatgtgggggacttactactacaggactcagaag
cagctatcaaaatccccaaagaacccttgtgatgagccaagcggaagtgtgagcagcagc
gggcctgacagcagcagcagcagcggggctggtgtggcttcttgtccccaaccgtggttt
gtggtcctagaagaacaccaagaccccaagaatgggagtctgcctgcggatggtacgaat
ggtgcagtagtagatgctggcctgtctccctccctgcgacttggatcagtgcatctgact
tcatggagacagaagccccacatagatggaatgggcacagggattccaccatcaagtgac
agaggaccccaggaaatggagggaaactcccacctaccctcctacagacctgtgggacct
gagaagctgcattctctccagtcagctaatggatcatgtcatcaaagggctccagacctg
ccagggcagacagagccagttcagtag

DBGET integrated database retrieval system