KEGG   Mus caroli (Ryukyu mouse): 110291027
Entry
110291027         CDS       T05910                                 

Gene name
Ralb
Definition
(RefSeq) ras-related protein Ral-B
  KO
K07835  Ras-related protein Ral-B
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110291027 (Ralb)
   04015 Rap1 signaling pathway
    110291027 (Ralb)
   04072 Phospholipase D signaling pathway
    110291027 (Ralb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291027 (Ralb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110291027 (Ralb)
   05212 Pancreatic cancer
    110291027 (Ralb)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    110291027 (Ralb)
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    110291027 (Ralb)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N
Other DBs
NCBI-GeneID: 110291027
NCBI-ProteinID: XP_021013626
Ensembl: MGP_CAROLIEiJ_G0014512
UniProt: A0A6P5PK24
LinkDB
Position
1
AA seq 206 aa
MAANKGKSQGSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKSEEDK
IPLLVVGNKSDLEERRQVPVDEARGKADEWGVQYVETSAKTRANVDKVFFDLMREIRAKK
MSENKDKNGRKSSKSKKSFKERCCLL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgccaacaagggcaagagccagggctccctggtacttcacaaggtcatcatggtt
ggcagtggaggggtcggcaagtcagccctgacgcttcagttcatgtatgacgagtttgta
gaagactatgagcccaccaaagccgacagttacagaaagaaggtggttctcgacggagaa
gaggttcagatagacatcctggacaccgctggccaggaggactacgcggccatccgcgac
aactacttccgaagtggagaaggctttctgctggtgttctccatcacagagcacgagtct
ttcacagccacagccgagttcagggaacagattctccgagtcaagtcggaggaggacaag
atcccactgctggtcgtgggcaacaagtccgacctggaggagcggaggcaggtgcccgtg
gatgaggcccgaggcaaagcagacgagtggggtgtgcagtacgtggagacatctgcaaag
acccgcgccaatgtggacaaggtgttctttgatctgatgagagaaatccgggcaaaaaag
atgtcggaaaacaaggacaagaacggcaggaaaagcagcaagagcaagaagagtttcaaa
gagcgatgctgcttgctgtga

KEGG   Mus caroli (Ryukyu mouse): 110308275
Entry
110308275         CDS       T05910                                 

Gene name
Rala
Definition
(RefSeq) ras-related protein Ral-A
  KO
K07834  Ras-related protein Ral-A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal05132  Salmonella infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110308275 (Rala)
   04015 Rap1 signaling pathway
    110308275 (Rala)
   04072 Phospholipase D signaling pathway
    110308275 (Rala)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110308275 (Rala)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110308275 (Rala)
   05212 Pancreatic cancer
    110308275 (Rala)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110308275 (Rala)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    110308275 (Rala)
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    110308275 (Rala)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 110308275
NCBI-ProteinID: XP_021036381
Ensembl: MGP_CAROLIEiJ_G0018247
UniProt: A0A6P5QZZ1
LinkDB
Position
13
AA seq 206 aa
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctgcaaacaagcccaagggtcagaattctttggccttacacaaagtcatcatggtg
ggcagtggtggtgtgggcaagtctgctctgactctgcagttcatgtacgatgagtttgta
gaggactatgaacctaccaaagcagacagctacaggaagaaggtcgtactggacggggaa
gaagtacagatcgacatcttagatacagcagggcaggaggactatgctgcaattagagac
aactacttccgaagtggggagggattcctctgtgtcttctctatcacagagatggagtcc
ttcgcagctacagcggacttcagggagcagattttaagagtaaaagaagatgagaatgtc
ccatttctcctggttggtaacaagtcagatctagaagataaaaggcaggtttctgtagaa
gaggcaaaaaacagagctgaccagtggaacgttaactatgtggagacgtctgctaaaacg
cgcgccaatgttgacaaggtattttttgatttaatgagggaaatacgagccagaaagatg
gaagacagcaaagaaaaaaatggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system