KEGG   Mus caroli (Ryukyu mouse): 110291094
Entry
110291094         CDS       T05910                                 

Gene name
Slc2a2
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 2
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04911  Insulin secretion
mcal04917  Prolactin signaling pathway
mcal04922  Glucagon signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04950  Maturity onset diabetes of the young
mcal04973  Carbohydrate digestion and absorption
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110291094 (Slc2a2)
   04922 Glucagon signaling pathway
    110291094 (Slc2a2)
   04917 Prolactin signaling pathway
    110291094 (Slc2a2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110291094 (Slc2a2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110291094 (Slc2a2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110291094 (Slc2a2)
   04950 Maturity onset diabetes of the young
    110291094 (Slc2a2)
   04931 Insulin resistance
    110291094 (Slc2a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110291094 (Slc2a2)
Transporters [BR:mcal02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   110291094 (Slc2a2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    110291094 (Slc2a2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Folate_carrier Phage_holin_2_3 OATP
Other DBs
NCBI-GeneID: 110291094
NCBI-ProteinID: XP_021013702
Ensembl: MGP_CAROLIEiJ_G0024895
UniProt: A0A6P5PGX6
LinkDB
Position
3
AA seq 523 aa
MSEDKITGTLAFTVFTAVLSSFQFGYDIGVINAPQEVIISHYRHVLGVPLDDRKATINYD
VNGTDTPLIVTPAYTTPALWDEEETEGSVHIVTMLWSLSVSSFAVGGMVASFFGGWLGDK
LGRIKAMLAANSLSLTGALLMGCSKFGPAHALIIAGRSVSGLYCGLISGLVPMYIGEIAP
TTLRGALGTLHQLALVTGILISQIAGLSFILGNQDHWHILLGLSAVPALLQCLLLLFCPE
SPRYLYIKLEEEVRAKKSLKRLRGTEDVTKDINEMKKEKEEASTEQKVSVIQLFTDANYR
QPILVALMLHMAQQFSGINGIFYYSTSIFQTAGISQPVYATIGVGAINMIFTAVSVLLVE
KAGRRTLFLTGMIGMFFCAIFMSVGLVLLDKFAWMSYVSMTAIFLFVSFFEIGPGPIPWF
MVAEFFSQGPRPTALALAAFSNWVCNFVIALCFQYIADFLGPYVFFLFAGVVLVFTLFTF
FKVPETKGKSFEEIAAEFRKKSGSAPPRKAAVQMEFLASSESV
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgtcagaagacaagatcactggaaccttggctttcactgtcttcactgctgtactcagt
tccttccagttcggatatgacatcggtgtaatcaatgcacctcaagaggtaataatatct
cattatcgacatgttttgggtgtcccactggatgaccggaaagctaccattaactatgac
gtcaatggcacagacaccccacttatagtcacaccagcatacacaacaccagctctctgg
gatgaagaggagactgaaggatctgttcacatagtcactatgctctggtctctgtctgtg
tccagcttcgcagtgggtggaatggtcgcctcattctttggtgggtggctcggggacaaa
cttggaaggatcaaagcaatgttggctgcaaacagcctctcattgactggagccctcttg
atgggatgttccaaatttggaccggcacacgccctcatcattgctggacgaagtgtatca
ggactgtattgtggactaatttcaggactggttccaatgtacattggagagatcgctcca
accacactcaggggtgccctgggtactcttcaccaactggcccttgtcacaggcattctt
attagtcagattgctggcctcagctttattctgggcaatcaggatcattggcacatccta
cttggcctatctgctgtgccagctcttctgcagtgtctgctgctgctcttctgtccagaa
agtcccagatacctttatataaagttggaagaggaagtcagggcaaagaaaagcttgaag
agactgagaggaactgaggatgtcaccaaagatattaatgagatgaagaaagaaaaggaa
gaggcatcgactgagcagaaggtctccgtgatccagctcttcacggatgccaattaccga
cagcccattctcgtggcactgatgctgcacatggcccagcagttctcaggaatcaatggg
atattttactattcaaccagcatttttcagacagctggcatcagccagcctgtgtatgca
accattggtgttggggccatcaacatgatcttcacggctgtctctgtgctgcttgtggag
aaggcagggcggcggaccctgttcctaaccgggatgattggcatgtttttctgcgccatc
ttcatgtcggtgggacttgtgctgctggataaattcgcctggatgagttacgtgagcatg
actgccatcttcctctttgtcagtttctttgagattgggccaggtccaatcccttggttc
atggttgctgaatttttcagccaaggaccccgtcctacggctctggcactggctgccttc
agcaactgggtctgcaattttgtcatcgccctctgcttccagtacattgcggacttcctc
gggccttacgtgttcttcctcttcgctggggtggtcctggtcttcaccctgtttacattc
tttaaagttccagaaaccaaaggaaagtcttttgaggaaatcgctgcagaattccggaag
aagagtggttcggccccaccacgcaaagctgctgtacaaatggaattcctggcgtcttca
gagagtgtgtga

DBGET integrated database retrieval system