KEGG   Mus caroli (Ryukyu mouse): 110291168
Entry
110291168         CDS       T05910                                 

Gene name
Foxo1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04068  FoxO signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04910  Insulin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04922  Glucagon signaling pathway
mcal04931  Insulin resistance
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110291168 (Foxo1)
   04152 AMPK signaling pathway
    110291168 (Foxo1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110291168 (Foxo1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110291168 (Foxo1)
   04922 Glucagon signaling pathway
    110291168 (Foxo1)
   04919 Thyroid hormone signaling pathway
    110291168 (Foxo1)
  09149 Aging
   04211 Longevity regulating pathway
    110291168 (Foxo1)
   04213 Longevity regulating pathway - multiple species
    110291168 (Foxo1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291168 (Foxo1)
   05202 Transcriptional misregulation in cancer
    110291168 (Foxo1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110291168 (Foxo1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110291168 (Foxo1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110291168 (Foxo1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110291168 (Foxo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110291168 (Foxo1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    110291168 (Foxo1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 110291168
NCBI-ProteinID: XP_021013809
Ensembl: MGP_CAROLIEiJ_G0024980
UniProt: A0A6P5PKF2
LinkDB
Position
3
AA seq 650 aa
MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLAS
ASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAASRGLCGDFQGPEAGCVHPAPPQPPPT
GPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQ
IYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGK
SGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSND
DFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEI
SNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYT
YGQSSMSPLPQMPMQPLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVA
QPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRALPHVVNT
MPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGM
FIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggccgaagcgccccaggtggtggagaccgacccggacttcgagccgctgccccggcag
cgctcctgtacctggccgctgcccaggccggagtttaaccagtccaactcgaccacctcc
agcccggcgccgtcgggcggcgcggccgccaaccccgacgccgcggcgagcctggcctcg
gcgtccgctgtcagcaccgactttatgagcaacctgagcctgctggaggagagtgaggac
ttcgcgcgggcgccgggctgcgtggccgtggcggctgcggccagcaggggcctgtgcggg
gacttccagggccccgaggcgggctgcgtgcacccggcgccgccacagcccccaccgacc
gggccgctgtcgcagcccccacccgtgcctccctccgctgcggccgccgcggggccactc
gcgggacagccgcgcaagaccagctcgtcgcgccgcaacgcgtggggcaacctgtcgtac
gccgacctcatcaccaaggccatcgagagctcagccgagaagaggctcaccctgtcgcag
atctacgagtggatggtgaagagcgtgccctacttcaaggataagggcgacagcaacagc
tcggcgggctggaagaattcaattcgccacaatctgtccctacacagcaagtttattcga
gtgcagaatgaaggaactggaaaaagttcttggtggatgctcaatccagagggaggcaag
agtggaaaatcaccccggagaagagctgcgtccatggacaacaacagtaaatttgctaag
agccgaggacgggctgctaagaaaaaagcatctctccagtccgggcaggagggtcctgga
gacagccctgggtctcagttttctaagtggcccgcgagtcctgggtcccacagcaatgat
gactttgataactggagtacatttcgtcctcgaaccagctcaaatgctagtaccatcagt
gggagactttctcccatcatgacagaacaggatgacctgggagatggggacgtgcattcc
ctggtatatccaccctctgctgccaagatggcgtctacgctgcccagtctgtctgaaatc
agcaatccagaaaacatggagaaccttctggataatctcaatcttctctcgtccccaaca
tctttaactgtgtcaacccagtcctcacctggcagcatgatgcagcagacaccgtgctat
tcgtttgcaccgccaaacaccagtctaaattcacccagtccaaactactcaaagtacaca
tacggccaatccagcatgagccctttgccccagatgcctatgcagccacttcaggacagc
aaatcaagttatggaggattgaaccagtataactgtgccccaggactcttgaaagagctg
ttgacttctgactctcctccccacaatgacattatgtcaccggttgatcccggagtggcc
caacccaacagtcgggtcctgggccaaaatgtaatgatgggccctaattcagtcatgcca
gcgtatggcagccaggcatctcataacaaaatgatgaaccccagctcccacacccaccct
ggacatgcgcagcaaacggcttcagtcaacggccgtgccctgccccatgtggtgaacacc
atgcctcacacatctgccatgaaccgcttgacccccgtgaagacacctttacaagtgcct
ctgtcccaccccatgcagatgagtgccctgggcagctactcctcagtgagcagctgcaat
ggctatggtaggatgggtgtcctccaccaggagaagctcccaagtgacttggatggcatg
tttattgagcgcttggactgtgacatggagtccatcattcggaatgacctcatggatgga
gataccttggattttaactttgataatgtgttgcccaaccaaagcttcccacacagtgtc
aagactacaacacacagctgggtgtcaggctaa

DBGET integrated database retrieval system