KEGG   Mus caroli (Ryukyu mouse): 110291180
Entry
110291180         CDS       T05910                                 

Gene name
Il2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04061  Viral protein interaction with cytokine and cytokine receptor
mcal04151  PI3K-Akt signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04630  Jak-STAT signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04672  Intestinal immune network for IgA production
mcal04940  Type I diabetes mellitus
mcal05135  Yersinia infection
mcal05142  Chagas disease (American trypanosomiasis)
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05320  Autoimmune thyroid disease
mcal05321  Inflammatory bowel disease (IBD)
mcal05330  Allograft rejection
mcal05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    110291180 (Il2)
   04151 PI3K-Akt signaling pathway
    110291180 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110291180 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110291180 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110291180 (Il2)
   04660 T cell receptor signaling pathway
    110291180 (Il2)
   04658 Th1 and Th2 cell differentiation
    110291180 (Il2)
   04659 Th17 cell differentiation
    110291180 (Il2)
   04672 Intestinal immune network for IgA production
    110291180 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291180 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110291180 (Il2)
   05321 Inflammatory bowel disease (IBD)
    110291180 (Il2)
   05330 Allograft rejection
    110291180 (Il2)
   05332 Graft-versus-host disease
    110291180 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110291180 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110291180 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110291180 (Il2)
   05162 Measles
    110291180 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    110291180 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcal04052]
    110291180 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110291180 (Il2)
Cytokines and growth factors [BR:mcal04052]
 Cytokines
  Interleukins
   110291180 (Il2)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Haparin
  Cytokines
   110291180 (Il2)
SSDB
Motif
Pfam: IL2 DUF773 Takusan
Other DBs
NCBI-GeneID: 110291180
NCBI-ProteinID: XP_021013825
Ensembl: MGP_CAROLIEiJ_G0024945
LinkDB
Position
3
AA seq 164 aa
MYSMQLASCVALTLVLLVNSAPTSSPTSSSTAEAQQQQQQQHLEQLLMDLQELLSRMENY
RNLKLPRMLTFKFYLPKQATELKDLQCLEDELGALRRVLDLTQSKSFQLEDAENFISNIR
VTVIKLKGSDNTFECRFDDESATVVEFLRRWIAFCQSIISTRTQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtacagcatgcagctcgcatcctgtgtcgcactgacacttgtgctccttgtcaacagt
gcacccacttcaagccccacttcaagctctacagcggaagcacagcagcagcagcagcag
cagcacctggagcagctgttgatggacctacaggagctcctgagcaggatggagaattac
aggaacctgaaactccccaggatgctcaccttcaaattttacttgcccaagcaggccaca
gaattgaaagatcttcagtgcctagaagatgaacttggagccctgcggcgtgtgctggat
ttgactcaaagcaaaagctttcaattggaagatgctgagaatttcatcagcaatatcaga
gtaactgttataaaactaaagggctctgacaacacatttgagtgccgattcgatgatgag
tcagcaactgtggtggagtttctgaggagatggatagccttctgtcaaagcatcatctca
acaaggactcaataa

DBGET integrated database retrieval system