KEGG   Mus caroli (Ryukyu mouse): 110291303
Entry
110291303         CDS       T05910                                 

Gene name
Hey1
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif protein 1
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04330  Notch signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110291303 (Hey1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291303 (Hey1)
  09162 Cancer: specific types
   05224 Breast cancer
    110291303 (Hey1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110291303 (Hey1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110291303 (Hey1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    110291303 (Hey1)
SSDB
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Other DBs
NCBI-GeneID: 110291303
NCBI-ProteinID: XP_021014032
Ensembl: MGP_CAROLIEiJ_G0024832
UniProt: A0A6P5PKY4
LinkDB
Position
3
AA seq 299 aa
MKRAHPDYSSSDSELDETIEVEKESADENGNLSSALCSMSPTTSSQVLARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHGGLGHIPW
GSAFGHHPHIAHPLLLPQNGHGNAGTAASSTEPHHQGRLASAHPEAPALRAPPSGGLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFSSFHLLSPSTPTQAANLGKPYRPWGTEIGAF
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaagagagctcacccagactacagctcctcggatagtgagctggacgagaccatcgag
gtggaaaaggagagcgcggacgagaatggaaacttgagttcggcgctgtgttccatgtcc
ccaacgacatcgtcccaggttttggccaggaaaagacggagaggcatcatcgagaagcgc
cgacgagaccgaatcaataacagtttgtctgagctgagaaggctggtacccagtgccttt
gagaagcagggatctgctaagctagaaaaagctgagatcttgcagatgactgtggatcac
ctgaaaatgctgcacactgcaggagggaaaggttattttgacgcgcacgccctggctatg
gactatcggagtttggggtttcgggaatgcctggccgaagttgcccgttatctgagcatc
attgaaggactcgatgcctccgacccgcttcgcgttcgcctggtctcccatctcaacaac
tacgcatcccagcgggaagccgcgagcggcgctcacggtggcctcggacacattccctgg
ggaagtgccttcggacatcacccacacatcgcacaccctctgctactgccccagaatggc
cacgggaacgctggcaccgcggcgtcatccacggagccgcatcaccagggcaggctggct
tctgcccatccggaggcgccggccttgcgagcgccccctagtggcggcttgggaccggtg
cttcccgtggtgacctcagcctccaaactgtctccaccgctgctctcctctgtggcctcg
ctctcagccttccctttttccttcagctccttccacctactgagcccttcgacacccacg
caggcagcaaaccttggcaagccctatagaccttgggggacagagatcggagctttctaa

KEGG   Mus caroli (Ryukyu mouse): 110293246
Entry
110293246         CDS       T05910                                 

Gene name
Heyl
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif-like protein
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04330  Notch signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110293246 (Heyl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110293246 (Heyl)
  09162 Cancer: specific types
   05224 Breast cancer
    110293246 (Heyl)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110293246 (Heyl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110293246 (Heyl)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    110293246 (Heyl)
SSDB
Motif
Pfam: HLH Hairy_orange
Other DBs
NCBI-GeneID: 110293246
NCBI-ProteinID: XP_021016774
Ensembl: MGP_CAROLIEiJ_G0026434
UniProt: A0A6P5PSE5
LinkDB
Position
4
AA seq 326 aa
MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSYAAEMEPSPTTTGALAFPVWPWSFL
HSCPGLPSLSSQLAILGRVPGPVLPSVSSPPYPISALRSAPVHRPAGTIPPTRRNLLPSR
GVTSTQRAHLPERPAAPPPTALDVRAARSIVPIPPCSPTTAPGAGKSDDNVSGSISSPCP
SGPTGRPAGAVFYHSWVSEITEIGAF
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaagcggcccagggcgcccagtggctcagacggcgagtctgatggacccatcgacgtg
ggtcaagagaacgatcttagccagatggccaggccgctgactacccccagcccttcgcag
atgcaagcccggaagaagcgcagagggatcatagagaaacggcgccgagaccgcatcaac
agtagcctttctgaattgcgacgattggtccccactgcctttgagaaacagggctcctcc
aagctggagaaagctgaggtcttgcagatgaccgtggatcacttgaagatgctccatgcc
tctggtggcacagggttctttgatgcccgagccctggctgttgacttccggagtattggg
tttcgggaatgcctcactgaggtcataagatacctgggggtcctggaaggacccagcagc
catgccgaccctgtccggattcgcctcctctcccacctcaagagctatgcagcagagatg
gagccctcacccacgaccaccggtgccctggcctttcccgtgtggccctggtccttcctg
catagctgtccaggcttgccttccctgagcagtcagctcgccatcctgggaagagtgccc
ggccctgtcctccccagcgtctcttctcccccttaccctatctcagccctgaggtcggca
ccagtgcacagacctgctggtaccatccccccaacccggcggaatttgttgcccagccga
ggggtgacttccacccagagagcccatcttcctgagaggccagctgcccctccacccaca
gcccttgatgtcagggctgccaggagcatagtcccaatcccaccatgttcccccacaaca
gcccctggagctgggaaatctgatgacaatgtgtctggttccatctccagcccatgtcct
tcggggccaaccgggaggcccgcgggagcagtgttctaccactcctgggtctcagaaatc
actgaaattggggctttctga

KEGG   Mus caroli (Ryukyu mouse): 110303306
Entry
110303306         CDS       T05910                                 

Gene name
Hey2
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif protein 2
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04330  Notch signaling pathway
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110303306 (Hey2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110303306 (Hey2)
  09162 Cancer: specific types
   05224 Breast cancer
    110303306 (Hey2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110303306 (Hey2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110303306 (Hey2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    110303306 (Hey2)
SSDB
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Other DBs
NCBI-GeneID: 110303306
NCBI-ProteinID: XP_021030045
Ensembl: MGP_CAROLIEiJ_G0015215
UniProt: A0A6P5QHT2
LinkDB
Position
10
AA seq 339 aa
MKRPCEETTSESDLDETIDVGSENNYPGHATSSVMRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALATD
FMSIGFRECLTEVARYLSTVEGLDPSDPLRVRLVSHLSTCASQREAAVMTSSMAHHHHPL
HPHHWAAAFHHLPTALLQPNGLHTSESTPCRLSTSSEVPPAHGSALLTATFAHADSALRM
PSGGTVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPSNAAAAAAVA
AATAISPPLSVSAASSPQQTSSGTNNKPYQPWGTEVGAF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaagcgcccttgtgaggaaacgacctccgaaagcgacctggacgagaccatcgatgtg
gggagcgagaacaattaccccgggcatgctacaagctcagtgatgaggtctaattcacct
acaactacctctcagattatggcaagaaaaaaaaggagagggatcatagaaaaaaggcgt
cgggatcgaataaataacagtttatctgaattgagaagactagtgccaacagcttttgaa
aaacaaggatctgccaagttggaaaaggctgaaatattgcaaatgacagtggatcatttg
aagatgctccaggctacagggggtaaaggctactttgatgcccatgctcttgccacagac
ttcatgagcattggattccgagagtgcttgacagaagtggctaggtacctaagcacagtg
gaaggccttgacccatcggacccactacgcgtgcgccttgtctctcatctcagcacctgt
gcctcccagcgggaggcagcagtgatgacatcctccatggcccaccaccatcaccccctg
caccctcaccactgggcagctgctttccaccatctccccacagccctgctccagcccaat
ggactccacacatcagagtcaaccccatgtcgcctatccacatcttcagaagtgcctcct
gctcatggctctgccctcctcacagcaacgtttgcccatgcagattctgctcttcggatg
ccatcagggggcaccgttgcaccctgtgtgccacctctctccacctctcttctgtctctt
tcggccactgtgcatgccgcagctgcagcagccactgcagctgcacacagcttccctctg
tccttcgcgggggcttttcccatgctcccgtccaatgcagcggcagcagccgctgttgct
gctgcaacggcaatcagcccacccttgtcagtatctgcagcctccagtcctcagcagaca
agcagtgggacaaacaataaaccttaccaaccctgggggacagaagttggagctttttaa

DBGET integrated database retrieval system