KEGG   Mus caroli (Ryukyu mouse): 110291472
Entry
110291472         CDS       T05910                                 

Gene name
Ccna2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04152  AMPK signaling pathway
mcal04218  Cellular senescence
mcal04914  Progesterone-mediated oocyte maturation
mcal05161  Hepatitis B
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110291472 (Ccna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110291472 (Ccna2)
   04218 Cellular senescence
    110291472 (Ccna2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110291472 (Ccna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291472 (Ccna2)
   05202 Transcriptional misregulation in cancer
    110291472 (Ccna2)
   05203 Viral carcinogenesis
    110291472 (Ccna2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110291472 (Ccna2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110291472 (Ccna2)
   05161 Hepatitis B
    110291472 (Ccna2)
   05169 Epstein-Barr virus infection
    110291472 (Ccna2)
   05165 Human papillomavirus infection
    110291472 (Ccna2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcal03032]
    110291472 (Ccna2)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110291472 (Ccna2)
DNA replication proteins [BR:mcal03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110291472 (Ccna2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110291472 (Ccna2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C
Other DBs
NCBI-GeneID: 110291472
NCBI-ProteinID: XP_021014303
Ensembl: MGP_CAROLIEiJ_G0024940
UniProt: A0A6P5PH35
LinkDB
Position
3
AA seq 422 aa
MPGTSRQSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKT
RRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFN
AAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEEKPVNVNEVPDYQEDIHTYLREME
VKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLR
GKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPT
VNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQ
SWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETL
SV
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgccgggcacctcgaggcagtcgggtcgcgatgcgggctcagccctgctctcgctgcat
caggaagaccaagagaatgtcaaccccgaaaaactggcgccagcccagcagccgcgggca
caggcggtgctgaaggccgggaacgtgcgtggacccgcgccgcagcagaagctcaagact
cgacgggttgctcctcttaaggaccttcctataaacgatgagcatgtcactgctggtcct
tcatggaaagcagtcagtaaacagcctgctttcaccattcatgtggatgaagcagaagag
actcagaagaggccagctgagcttaaagaaacagagtgtgaagatgccctggcttttaat
gcagctgtctctttacccggagcaagaaaaccactgacacctcttgactatccaatggat
ggcagttttgaatcaccacatgctatggatatgtctattgtcttagaagaaaagccagtg
aacgttaatgaagtacctgactatcaagaagacattcacacgtaccttagggaaatggag
gttaaatgtaaacctaaagtgggttacatgaagaggcagccagacatcactaacagcatg
cgggccattctcgtggactggctggttgaggtgggagaagaatataaactacagaatgag
accctgcatttggctgtgaactacattgatagattcctctcctccatgtctgtgttaaga
gggaagcttcagcttgtgggcacagctgctatgctgctagcttcgaagtttgaagaaata
taccccccagaagtagcagagtttgtgtatattacagacgatacctattccaagaagcag
gttctgagaatggagcacctagtattgaaagtccttgcttttgacttggctgcaccaaca
gtaaatcagttccttacccagtacttcctacacctgcagcctgcaaactgtaaggttgaa
agcttagcaatgtttttgggagaactgagtttgatagatgctgacccgtaccttaagtat
ttgccttcacttattgctggagctgcctttcacttagctctctacacagtcacaggacag
agttggcctgagtcattggcacaacagactggatataccctggaaagtcttaagccttgt
cttgtggaccttcaccagacctacctcaaagccccacaacatgcccaacagtcgatacgg
gaaaagtacaagcattcaaaatatcacagtgtttctcttctcaacccaccagagacacta
agtgtgtga

KEGG   Mus caroli (Ryukyu mouse): 110291693
Entry
110291693         CDS       T05910                                 

Gene name
Ccna1
Definition
(RefSeq) cyclin-A1 isoform X1
  KO
K06627  cyclin-A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04152  AMPK signaling pathway
mcal04218  Cellular senescence
mcal04914  Progesterone-mediated oocyte maturation
mcal05161  Hepatitis B
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110291693 (Ccna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110291693 (Ccna1)
   04218 Cellular senescence
    110291693 (Ccna1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110291693 (Ccna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291693 (Ccna1)
   05202 Transcriptional misregulation in cancer
    110291693 (Ccna1)
   05203 Viral carcinogenesis
    110291693 (Ccna1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110291693 (Ccna1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110291693 (Ccna1)
   05161 Hepatitis B
    110291693 (Ccna1)
   05169 Epstein-Barr virus infection
    110291693 (Ccna1)
   05165 Human papillomavirus infection
    110291693 (Ccna1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcal03032]
    110291693 (Ccna1)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110291693 (Ccna1)
DNA replication proteins [BR:mcal03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110291693 (Ccna1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110291693 (Ccna1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Peroxidase_2 Cyclin_N2
Other DBs
NCBI-GeneID: 110291693
NCBI-ProteinID: XP_021014610
Ensembl: MGP_CAROLIEiJ_G0024997
UniProt: A0A6P5PJ28
LinkDB
Position
3
AA seq 421 aa
MHRQSSKSGVALPPVGQGPDACQMLSRAQLGQDPPQRTVLGVLTENEQYRRTCGQEITAI
RCFSGSENAFPAAGKKVLPDHGVHEPAKRGFDIYMDDPEQGDRDSCSGKEGIVFEDVYEV
DTSMLKSDLHFLLDFNTVSPMLVDPTTHAQSEEATDFGSDVINVTEYAEEIHRYLREAEV
RHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLVAAAAYCLANYIVNRHFW
PETLAAFTGYSLNEIVPCLSELHKACLSIPHRPQQAIREKYKASKYLHVSLMEPPVVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatcgccagagctccaagagtggagtcgctctgcctccagtgggccaaggtcctgat
gcttgtcaaatgctcagcagagctcagcttggccaggatcccccacagagaacggtgcta
ggggtgttgactgaaaatgagcagtacaggaggacctgtggccaggagatcacagcaatc
agatgtttttctggatcagaaaatgccttccctgcagctggaaagaaagtgctccctgac
catggggtccatgaaccagccaagcgtgggtttgatatctacatggatgaccctgaacag
ggggacagagacagctgctcggggaaagagggcatcgtatttgaggatgtgtatgaagtc
gacaccagcatgctcaagtcagatctccacttcctgctggatttcaacacagtttcccca
atgctggttgaccccaccacccatgcccagtcagaggaagcaacagattttggttcagat
gtgattaacgtaacggaatatgcagaggagattcatcgctaccttcgagaagctgaagta
agacacagacccaaggctcactacatgaggaagcagccggacatcacggagggcatgcgc
gccatcctggtggactggctggtggaggttggggaagaatataaacttcgcacagagacc
ctgtacttggctgtcaacttcctggacaggtttctctcctgcatgtctgtcctgagaggg
aaattgcagcttgtcgggacagcagctattctcctggcttcgaaatatgaagagatatat
ccacccgacgtggatgagtttgtctacatcaccgacgatacgtacacgaagcgacagcta
ctgaggatggagcatctgctactcaaagtcctggcatttgatctgaccgttccaaccact
aaccagttcctcctccaatacctaaggcgtcaaggagtgtgcatcaggactgagaatttg
gccaagtatgttgcagaactgagccttctggaagctgacccattcttgaagtatcttcct
tccttggttgctgcagcagcttactgcctggcaaactatattgtgaacagacacttctgg
ccagaaacgcttgctgcatttacgggctattcattaaatgagattgtgccttgcctgagt
gagctgcataaagcatgcctcagtatcccccatcgaccgcagcaagcaatcagggagaag
tacaaggcttcgaagtacctgcacgtgtccctcatggagccgcctgtagttcttcccctg
cagtga

DBGET integrated database retrieval system