KEGG   Mus caroli (Ryukyu mouse): 110291639
Entry
110291639         CDS       T05910                                 

Gene name
Pbx1
Definition
(RefSeq) pre-B-cell leukemia transcription factor 1 isoform X1
  KO
K09355  pre-B-cell leukemia transcription factor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04927  Cortisol synthesis and secretion
mcal04934  Cushing syndrome
mcal05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    110291639 (Pbx1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110291639 (Pbx1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110291639 (Pbx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110291639 (Pbx1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, PBC
    110291639 (Pbx1)
SSDB
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin HTH_3 Sec15 LZ3wCH
Other DBs
NCBI-GeneID: 110291639
NCBI-ProteinID: XP_021014536
Ensembl: MGP_CAROLIEiJ_G0014829
LinkDB
Position
1
AA seq 430 aa
MEEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP
EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM
NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF
NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQG
AQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
PGSVHSDTSN
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggaggagcagccgaggctgatgcattcccacgctggggtcgggatggccggacacccc
ggcctgtcccagcacttgcaggatggggccggagggaccgagggggagggcgggaggaag
caggacatcggggacattttacagcaaattatgaccatcacagaccagagtttggatgaa
gcgcaggccagaaaacatgctttaaactgccacagaatgaagcctgccttgtttaatgtg
ttgtgtgaaatcaaagaaaaaacagttttgagtattcggggagcccaagaagaggagccc
acagacccccagctcatgcgactggacaacatgctgctagcagaaggggtggcggggcct
gagaagggcggaggctcagcagcggcggcagcagcagcggcagcttctgggggtgcaggc
tcagacaactcagtggagcattccgattacagagccaaactctcacagatcagacaaatc
taccacacagagctggagaagtatgagcaggcatgcaatgaattcaccacccacgtgatg
aacctccttcgagagcaaagccggaccaggcccatctctccgaaggagatcgagcggatg
gtgagcatcatccaccgcaagttcagctccatccagatgcagctgaaacagagcacatgc
gaggccgtcatgatcctgcgctcccggttcctggatgcgaggcggaagagacggaatttc
aacaagcaagccacagaaattctgaatgaatatttctattcccatctcagcaacccttac
cccagtgaggaagccaaagaggagttagccaagaagtgcggcatcacagtctcccaggta
tcaaactggtttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagag
gaagccaatatttatgctgccaaaacggctgtcacagccaccaatgtgtcagcccatgga
agccaagctaactcgccctctactcccaactcagcgggttcttccagttcttttaacatg
tcaaactctggagatttgttcatgagcgtgcagtcactcaatggggattcttaccaaggg
gcccaggttggagccaacgtgcaatcacaggtggatacccttcgccatgttatcagccag
acaggaggatacagtgacggactcgcagccagtcagatgtacagtccgcagggcatcagt
gctaatggaggttggcaggatgctactaccccttcatcagtgacctcccctacagaaggc
cctggcagtgttcactctgatacctccaactga

DBGET integrated database retrieval system