KEGG   Mus caroli (Ryukyu mouse): 110291859
Entry
110291859         CDS       T05910                                 

Gene name
Prcc
Definition
(RefSeq) proline-rich protein PRCC
  KO
K13105  proline-rich protein PRCC
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05202  Transcriptional misregulation in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110291859 (Prcc)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110291859 (Prcc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mcal03041]
    110291859 (Prcc)
Spliceosome [BR:mcal03041]
 Complex B
  Other components
   Prp19-related factors
    110291859 (Prcc)
SSDB
Motif
Pfam: PRCC
Other DBs
NCBI-GeneID: 110291859
NCBI-ProteinID: XP_021014749
Ensembl: MGP_CAROLIEiJ_G0025143
UniProt: A0A6P5PBW4
LinkDB
Position
3
AA seq 473 aa
MSLVAYASSDDSEPDEPEPEPEPEEEDVAAPMPGPTLGGLFASLPAPKGPALLPPXPQML
APAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPAGVSPAEAAGVGEGLGLPSPQGPGL
SLPPAVGGVGPPLGLPKPKKRTEPVRIAAPELQKGDSDSEEDEPAKKKVVLQGSGEGTGL
SALLPQPKNLTVKETNRLLLPHAFSRKPSDISSDAKPSRLASKTKPASLAPVLGTTTTTP
SPSAIKAAAKSAALQVTKQITQEDDDSDEEVAPENFFSLPDKAEPPGVEPYPYPVPTVPE
ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYY
QDYYSGGYYPAPDPALVPPQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQVRMLRAHSIP
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtctctggttgcttatgccagcagcgacgatagtgagccggatgagccggagccggag
ccggagccggaggaagaggatgtggcggctcctatgccggggcccactttaggaggcctg
ttcgcttctcttcctgcacccaaaggcccggccttgctgcccccgnccccccagatgctg
gccccagccttccccccgccgctcctgctgcccccgcccaccggagaccccagactgcag
ccgcctccgccgctgccctttggcctgggcggcttcccgccacctgcaggagtgagccct
gctgaagctgcgggagttggagaggggctggggctgccatcgcctcaaggccccgggctc
agtctgcccccagctgtgggcggtgtcggaccccccttgggccttcccaagccaaagaag
agaaccgaaccggttaggatagcggcgccggagctgcagaagggcgattcagattctgag
gaagatgagcctgcgaagaagaaagttgtcctgcagggatccggcgaggggactggtttg
tctgccttgctcccccaacctaaaaacctgactgtgaaagagactaacaggttgctcctg
ccccatgccttctcccggaaaccctcagatatctcctcagatgctaagccctctagattg
gcttctaagaccaagcccgcctcacttgctcctgttttgggtaccacaaccaccactcca
tcaccctctgccatcaaggctgctgccaagagtgctgccctgcaggtgaccaagcagata
acacaggaggatgacgacagtgacgaggaagttgctcctgagaactttttctccctccct
gacaaggctgagccacctggagttgagccatacccttaccctgtccccactgtccctgaa
gagctgcctccaggcacagaaccagaaccagctttccaggacgatgcagccaatgccccc
cttgagtttaagatggcggcagggtcaagtggagctccctggatgccgaagcctggggat
gactacagctacaatcagttttccacatatggcgatgccaatgctgctggtgcttattat
caggattactacagtggtggctactatcctgcaccggacccggctctggtccctccccag
gaaattgcccctgatgcctctttcattgatgatgaagcatttaagcggctgcagggcaag
aggaaccgagggagagaggaaatcaactttgtggagatcaaaggtgatgaccaactcagt
ggggctcagcagtggatgaccaagtcactgacagaagagaaaaccatgaagtccttcagc
aaaaagaaaggtgaacagccaactggccagcagcggaggaaacaccagatcacatatctg
attcatcaggtgaggatgctcagggctcacagcattccataa

DBGET integrated database retrieval system