KEGG   Mus caroli (Ryukyu mouse): 110291975
Entry
110291975         CDS       T05910                                 

Gene name
Casp8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal04115  p53 signaling pathway
mcal04210  Apoptosis
mcal04215  Apoptosis - multiple species
mcal04217  Necroptosis
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04668  TNF signaling pathway
mcal04932  Non-alcoholic fatty liver disease
mcal05010  Alzheimer disease
mcal05016  Huntington disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05134  Legionellosis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110291975 (Casp8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110291975 (Casp8)
   04215 Apoptosis - multiple species
    110291975 (Casp8)
   04217 Necroptosis
    110291975 (Casp8)
   04115 p53 signaling pathway
    110291975 (Casp8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110291975 (Casp8)
   04621 NOD-like receptor signaling pathway
    110291975 (Casp8)
   04622 RIG-I-like receptor signaling pathway
    110291975 (Casp8)
   04625 C-type lectin receptor signaling pathway
    110291975 (Casp8)
   04657 IL-17 signaling pathway
    110291975 (Casp8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110291975 (Casp8)
   05203 Viral carcinogenesis
    110291975 (Casp8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110291975 (Casp8)
   05016 Huntington disease
    110291975 (Casp8)
   05022 Pathways of neurodegeneration - multiple diseases
    110291975 (Casp8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110291975 (Casp8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110291975 (Casp8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110291975 (Casp8)
   05134 Legionellosis
    110291975 (Casp8)
   05152 Tuberculosis
    110291975 (Casp8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110291975 (Casp8)
   05161 Hepatitis B
    110291975 (Casp8)
   05160 Hepatitis C
    110291975 (Casp8)
   05164 Influenza A
    110291975 (Casp8)
   05162 Measles
    110291975 (Casp8)
   05168 Herpes simplex virus 1 infection
    110291975 (Casp8)
   05163 Human cytomegalovirus infection
    110291975 (Casp8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110291975 (Casp8)
   05169 Epstein-Barr virus infection
    110291975 (Casp8)
   05165 Human papillomavirus infection
    110291975 (Casp8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110291975 (Casp8)
   05142 Chagas disease
    110291975 (Casp8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110291975 (Casp8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110291975 (Casp8)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     110291975 (Casp8)
Peptidases and inhibitors [BR:mcal01002]
 Cysteine peptidases
  Family C14: caspase family
   110291975 (Casp8)
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN AIG1
Other DBs
NCBI-GeneID: 110291975
NCBI-ProteinID: XP_021014815
Ensembl: MGP_CAROLIEiJ_G0014170
UniProt: A0A6P7RDQ1
LinkDB
Position
1
AA seq 481 aa
MDFQSCLYDIAEELGSEDLAALKFLCLDYIPHKKQESIEDAQVLFVRLREKGMLEEGNLA
FLKELLFHISRWDLLVNFLDCNREEMVRELRDLDNAQISPYRVMLFKLSEEVSESELRSF
KFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLGTLKSICGQVNKSLLGKIEDYER
PSTERRLSLEGMEELSLSGLDEMSLKMPELCDSPREQDSESRTSDKVYQMKNKPRGYCLI
INNYDFSKAREDIPHLRKMKDRKGTNCDKEALSETFKELHFEIVSYNDCTANEIHEILED
YQRIDHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLAGKPKIFFIQ
ACQGNNFQKGVPDEAGLEQQHNTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPMNG
TWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRKNKGKQMPQPSFTLRKKLFFPP
Y
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggatttccagagttgtctttatgatattgctgaagaacttggcagtgaagacctggct
gccctcaagttcctgtgcttggactacatcccacacaagaagcaggagtccatcgaggat
gcccaggtgctatttgtgaggctgcgggaaaaggggatgttggaggaaggcaatctggct
ttcctgaaggagctgcttttccacatcagtcggtgggacctgctggtcaacttcctagac
tgcaaccgagaggagatggtgagagagctgcgggatctagacaatgcccagatttctccc
tacagggtcatgctctttaagctctcagaagaagtgagcgagtcggaattgagatctttt
aagttccttttgaacaatgagatccccaaatgtaagctggaagatgacttgagcctgctt
gaaatttttgtagaaatggagaagaggaccatgctggcagaaaataacttgggaacccta
aagtccatctgtggccaggtcaacaagagcctgctggggaagatcgaggattatgaaaga
ccaagcacagagagaagattgagccttgaaggaatggaagagttgtcactttcgggtttg
gatgagatgagcctcaaaatgccggaactgtgtgactcgccaagagaacaagacagtgag
tcacggacttcagacaaagtttaccaaatgaagaacaaacctcggggatactgtctgatc
atcaacaattatgatttcagcaaggcccgggaagacataccccacctccgaaaaatgaag
gacagaaaaggaacaaactgtgataaagaggctctgagtgagacctttaaggagcttcat
tttgagatagtatcttacaatgattgcaccgcaaatgaaatccatgagattctagaagat
taccaaagaatagaccacaagaacaaagactgcttcatatgctgtatcctatcccacggt
gacaagggtgtcgtctatggaacggatgggaaggaggcctccatctatgaccttacatct
tacttcactggttcaaagtgcccttccctggctgggaaacccaagatctttttcattcag
gcttgccaaggaaataacttccagaaaggagtgcctgatgaggcaggcttagaacaacag
cacaacactttagaagtggattcatcatctcacaagaactatattccggatgaggcagac
tttctgctgggaatggctacggtgaagaactgcgtttcctaccgagatcctatgaatgga
acctggtatattcagtcactttgccagagcctgagggaaagatgtcctcaaggagacgac
attctcagcatcctgactggcgtgaactatgatgtgagcaataaagacgacaggaagaac
aagggaaagcagatgccacagccctccttcacactacggaagaagctcttcttccctccc
tactga

DBGET integrated database retrieval system