KEGG   Mus caroli (Ryukyu mouse): 110292124
Entry
110292124         CDS       T05910                                 

Gene name
Ccne2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04934  Cushing syndrome
mcal05161  Hepatitis B
mcal05162  Measles
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05215  Prostate cancer
mcal05222  Small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110292124 (Ccne2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110292124 (Ccne2)
   04114 Oocyte meiosis
    110292124 (Ccne2)
   04115 p53 signaling pathway
    110292124 (Ccne2)
   04218 Cellular senescence
    110292124 (Ccne2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292124 (Ccne2)
   05206 MicroRNAs in cancer
    110292124 (Ccne2)
   05203 Viral carcinogenesis
    110292124 (Ccne2)
  09162 Cancer: specific types
   05226 Gastric cancer
    110292124 (Ccne2)
   05215 Prostate cancer
    110292124 (Ccne2)
   05222 Small cell lung cancer
    110292124 (Ccne2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110292124 (Ccne2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292124 (Ccne2)
   05161 Hepatitis B
    110292124 (Ccne2)
   05162 Measles
    110292124 (Ccne2)
   05169 Epstein-Barr virus infection
    110292124 (Ccne2)
   05165 Human papillomavirus infection
    110292124 (Ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcal03032]
    110292124 (Ccne2)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110292124 (Ccne2)
DNA replication proteins [BR:mcal03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110292124 (Ccne2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110292124 (Ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110292124
NCBI-ProteinID: XP_021014897
Ensembl: MGP_CAROLIEiJ_G0025805
UniProt: A0A6P7R4V6
LinkDB
Position
4
AA seq 404 aa
MSRRSSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEEITKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQK
ENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDV
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCP
VTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTH
TNYLALLNEVNYVNIYRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaagcaacatgcccagcccaaccagccagac
tctccgcaagaaacccagataattcaggccaagaagagaaaaacagcacaggatgtcaaa
aaaagaaaagaagagatcaccaagaagcatcaatatgagattaggaattgttggccacct
gtactgtctggaggaatcagcccttgcattatcattgaaacaccccataaagaaatagga
acaagtgacttctctagatttacaaattacagatttaaaaatctttttattaatccctca
cctctgccagatttaagctgggcatgttcacaggaggtttggcaaaacatgttacaaaag
gaaaacagatacgtgcatgacaaacattttcaagttctgcattctgacctggaaccacag
atgaggtcaatacttttagactggcttttagaggtttgtgaagtatacactcttcatagg
gagacattttaccttgcccaagacttttttgacagatttatgttgacacaaaaggatgta
aataaaaatatgcttcaactcattgggattacctcattgttcattgcttccaaacttgag
gaaatctacgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gtagatatcttaaagatggaactcaatatattaaaggctttaaaatgggaactttgtccg
gtaacagtcatctcctggttgaatctttttcttcaagttgatgctgttaaagatgttcct
aaggttcttctacctcaatattctcaggagacgttcatccagatagctcagcttttagat
ctgtgcattctagccatcgactctttagaatttcaatacagaattctggctgctgctgcc
ttatgccattttacctccattgaagtggttaagaaagcttcaggtttggaatgggatgac
atctcagaatgtgtagactggatggtgccttttgttagtgttgtaaaaagtgtaagtcca
gtgaagctgaagacttttaagaagatacccatggaagatagacacaatatccagacacac
acaaattatttggctttgctgaatgaagtaaactatgtgaacatctacagaaaaggaggg
cagctgtcaccagtgtgtaatggaggcattatgacaccaccaaagagcactgaaaaacca
ccaggaaaacactga

KEGG   Mus caroli (Ryukyu mouse): 110298604
Entry
110298604         CDS       T05910                                 

Gene name
Ccne1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04115  p53 signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04934  Cushing syndrome
mcal05161  Hepatitis B
mcal05162  Measles
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05215  Prostate cancer
mcal05222  Small cell lung cancer
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110298604 (Ccne1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110298604 (Ccne1)
   04114 Oocyte meiosis
    110298604 (Ccne1)
   04115 p53 signaling pathway
    110298604 (Ccne1)
   04218 Cellular senescence
    110298604 (Ccne1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110298604 (Ccne1)
   05206 MicroRNAs in cancer
    110298604 (Ccne1)
   05203 Viral carcinogenesis
    110298604 (Ccne1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110298604 (Ccne1)
   05215 Prostate cancer
    110298604 (Ccne1)
   05222 Small cell lung cancer
    110298604 (Ccne1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110298604 (Ccne1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110298604 (Ccne1)
   05161 Hepatitis B
    110298604 (Ccne1)
   05162 Measles
    110298604 (Ccne1)
   05169 Epstein-Barr virus infection
    110298604 (Ccne1)
   05165 Human papillomavirus infection
    110298604 (Ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcal03032]
    110298604 (Ccne1)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110298604 (Ccne1)
DNA replication proteins [BR:mcal03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110298604 (Ccne1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110298604 (Ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110298604
NCBI-ProteinID: XP_021023603
Ensembl: MGP_CAROLIEiJ_G0029597
UniProt: A0A6P5Q2N4
LinkDB
Position
7
AA seq 411 aa
MPRERKERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQ
PWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRI
MLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMAS
QQNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKW
RLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVL
AASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHN
IQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgccaagggagaggaaggagagagactcgacggaccacagcaacatgaaagaagaaggt
ggctccgacctttcagtccgctccagaaaaaggaaggcaaatgtggccgtgtttttgcaa
gacccagatgaagaaattgccaagattgacaagactgtgaaaagtgaggatagcagtcag
ccctgggatgataattcagcatgcgtggacccctgctctttcatccccacccctaacaaa
gaagaggacaatgagcttgaataccccaggactgcatttcagcctcggaaaatcagacca
cccagagcctccccacttcccgtcttgaattggggcaatagagaggaggtctggaggatc
atgttaaacaaagaaaagacttacctgagagatgagcacttcctgcagcgccatcctctc
ctgcaggcgaggatgagagcagttcttctggattggctaatggaggtgtgcgaagtctat
aagctccacagagagacgttctacttggcacaggacttctttgatcgttacatggcatca
caacagaatatcataaaaacacttttacagcttattgggatttcagccttatttattgct
tcaaaacttgaggaaatctaccctccaaagctacaccagtttgcttatgttacagacggc
gcttgctccggggatgaaattcttaccatggaattgatgatgatgaaggcccttaagtgg
cgtctaagccctctgaccattgtgtcctggctgaatgtgtatgtccaagtggcctatgtc
aacgacacgggtgaggtactgatgcctcagtacccacagcaggtctttgtgcagatcgca
gagcttctagacctgtgcgtcctggatgttggctgcttagaatttccttatggcgtcctc
gctgcttctgctttgtatcacttctcctcactggagttgatgcagaaggtctcaggttat
cagtggtgtgacatagagaagtgtgtcaaatggatggttccgttcgccatggttatccgg
gagatgggaagttccaagctcaagcacttccggggagtccccatggaagactcccacaac
atccagacccacaccaacagcttggatttgctggacaaagcccaagcaaagaaagccata
ttgtcagaacagaataggatttctcctcctccgagtgtggtcctgacacccccacccagc
agtaagaagcagagcagtgagcaggagacagaatga

DBGET integrated database retrieval system