KEGG   Mus caroli (Ryukyu mouse): 110292203
Entry
110292203         CDS       T05910                                 

Gene name
Slc2a1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04066  HIF-1 signaling pathway
mcal04911  Insulin secretion
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04922  Glucagon signaling pathway
mcal04931  Insulin resistance
mcal04976  Bile secretion
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    110292203 (Slc2a1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110292203 (Slc2a1)
   04922 Glucagon signaling pathway
    110292203 (Slc2a1)
   04920 Adipocytokine signaling pathway
    110292203 (Slc2a1)
   04919 Thyroid hormone signaling pathway
    110292203 (Slc2a1)
  09154 Digestive system
   04976 Bile secretion
    110292203 (Slc2a1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292203 (Slc2a1)
   05230 Central carbon metabolism in cancer
    110292203 (Slc2a1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110292203 (Slc2a1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110292203 (Slc2a1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292203 (Slc2a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110292203 (Slc2a1)
Transporters [BR:mcal02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   110292203 (Slc2a1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    110292203 (Slc2a1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 DUF523
Other DBs
NCBI-GeneID: 110292203
NCBI-ProteinID: XP_021015016
Ensembl: MGP_CAROLIEiJ_G0026388
UniProt: A0A6P5PJZ0
LinkDB
Position
4
AA seq 492 aa
MDPSSKKVTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWNHRYGEPIPSTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVAAVLMGFSKLAKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM
GNADLWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEEGRQMMREKKVTILELFRSPAYCQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLER
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggatcccagcagcaagaaggtgactggccgcctcatgttggctgtgggaggagcagtg
ctcggatcactgcagtttggctataacactggtgtcatcaacgccccccagaaggttatt
gaggagttctacaatcaaacatggaaccaccgctacggagagcccatcccatccaccaca
ctcaccacgctttggtctctctccgtggccatcttctctgttgggggcatgattggttcc
ttctctgtcggcctctttgttaatcgctttggcaggcggaactccatgctgatgatgaac
ctgttggcctttgtggctgctgtgcttatgggcttctccaaactggccaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgtggcctgactactggctttgtg
cccatgtatgtgggagaggtgtcacctacagctctacgtggagccctaggcacactgcac
cagctgggaattgtcgttggcatccttattgcccaggtgtttggcttagactccatcatg
ggcaatgcagacttgtggcctctgctgctcagtgtcatcttcatcccagccctgctacag
tgtatcctgttgcccttctgccccgagagcccccgcttcctgctcatcaatcgtaacgag
gagaaccgggccaagagtgtgctgaagaagcttcgagggacagccgatgtgacccgagac
ctgcaggagatgaaagaagagggtcggcagatgatgcgggagaagaaggtcaccatcttg
gagctgttccgctcacccgcctactgccagcccatcctcatcgctgtggtgctgcagctg
tcccagcagctgtcgggtatcaatgctgtgttctactactcaacgagcatcttcgagaag
gcaggtgtgcagcagcctgtgtatgccaccatcggctcgggtatcgtcaacacggccttc
actgtggtgtcgctgttcgttgtagagcgagctggacgacggaccctgcacctcattggc
ctggctggcatggcaggctgtgctgtgctcatgaccatcgccctggccttgctggaacgg
ctgccttggatgtcctatctgagcatcgtggccatctttggctttgtggccttctttgaa
gtaggccctggtcctattccatggttcattgtggccgagctgttcagccaggggccccgt
cctgctgctattgctgtggccggcttctccaactggacctcaaacttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggcccctacgtcttcatcatcttcacggtgctg
cttgtgctcttcttcatcttcacctacttcaaagtccctgagaccaaaggccggaccttc
gatgagatcgcttccggcttccggcaggggggtgccagccaaagtgacaagacacccgag
gagctcttccaccctctgggggcggactcccaagtgtga

DBGET integrated database retrieval system