KEGG   Mus caroli (Ryukyu mouse): 110292243
Entry
110292243         CDS       T05910                                 

Gene name
Jak1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04380  Osteoclast differentiation
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04621  NOD-like receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal05140  Leishmaniasis
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05212  Pancreatic cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110292243 (Jak1)
   04151 PI3K-Akt signaling pathway
    110292243 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110292243 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110292243 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110292243 (Jak1)
   04658 Th1 and Th2 cell differentiation
    110292243 (Jak1)
   04659 Th17 cell differentiation
    110292243 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110292243 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292243 (Jak1)
   05203 Viral carcinogenesis
    110292243 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110292243 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110292243 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110292243 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292243 (Jak1)
   05161 Hepatitis B
    110292243 (Jak1)
   05160 Hepatitis C
    110292243 (Jak1)
   05171 Coronavirus disease - COVID-19
    110292243 (Jak1)
   05164 Influenza A
    110292243 (Jak1)
   05162 Measles
    110292243 (Jak1)
   05168 Herpes simplex virus 1 infection
    110292243 (Jak1)
   05163 Human cytomegalovirus infection
    110292243 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292243 (Jak1)
   05169 Epstein-Barr virus infection
    110292243 (Jak1)
   05165 Human papillomavirus infection
    110292243 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110292243 (Jak1)
   05140 Leishmaniasis
    110292243 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110292243 (Jak1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110292243 (Jak1)
Protein kinases [BR:mcal01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110292243 (Jak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 110292243
NCBI-ProteinID: XP_021015091
Ensembl: MGP_CAROLIEiJ_G0026203
UniProt: A0A6P5PK49
LinkDB
Position
4
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVVPEPGVEVTFYLLDREPLRLGSGEYTAEEL
CIRAAQECSISPLCHNLFALYDESTKLWYAPNRIITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKRVPEATPLLDASSLEYLFAQGQYDLIKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELS
RCHSNDSGNVLYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLEYNKHKKDDERNKLR
EEWNNFSYFPEITHIVIKESVVSINKQDNKNMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSMDHFPSLRDLMNHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGT
LLDYKDEEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSDIGPFIKLSDPGIPVSVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
FSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTT
FQSLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggcgttctgtgctaaaatgagg
agcttcaagaagactgaggtgaagcaggtggtccctgagccaggagtggaggtgactttc
tatctgttggacagggagcccctccgcctgggcagcggagagtatacagccgaggagctg
tgcatcagggccgcccaggagtgcagtatctctcctctctgtcacaacctcttcgccctg
tatgatgagagcaccaagctctggtacgctccgaaccgaatcatcactgtggatgacaaa
atgtctctccggctccactaccgcatgaggttctactttaccaactggcacggaaccaat
gacaacgaacagtctgtgtggcgacattctccaaagaagcagaaaaacggctatgagaag
aaaagggttccagaagcaaccccactccttgatgccagttcactggagtatctgtttgca
cagggacagtatgatttgatcaaatgcctggctcccattcgggaccccaagacggagcaa
gacggacatgatattgagaatgagtgcctgggcatggcggtcctggccatctcccactat
gccatgatgaagaagatgcagttgccggaacttcccaaagacatcagctacaagcgatat
attccagaaacattgaataaatccatcagacagaggaacctccttaccaggatgcgaata
aataatgttttcaaggatttcttgaaggaatttaacaacaagaccatctgtgacagcagt
gtgtctacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggagctgaaatatttgagacttctatgctactgatatcatcagaaaatgaattgagt
cggtgccattcgaatgacagtggcaatgttctctatgaagtcatggtgactggaaatctc
gggatccagtggcggcagaaaccaaatgttgttcctgttgaaaaggaaaaaaataaactg
aagcggaaaaaactggaatataataaacacaagaaggatgatgagagaaacaaactccgg
gaagagtggaacaatttttcctatttccctgaaatcacccatattgtaataaaggagtct
gtggtcagcattaacaaacaggacaacaaaaacatggaactcaagctctcttctcacgag
gaagccttgtcctttgtgtccctggtggatggctacttccggctcactgcagatgcccac
cattacctctgtactgatgtggctcccccactgattgtccacaatatacagaacggctgt
cacggtccaatctgcacagagtatgccatcaataagctgcggcaggaagggagtgaagag
gggatgtacgtgctgaggtggagctgcactgactttgacaacattcttatgactgtcacc
tgctttgagaagtctgaggtattgggtggccagaagcagttcaagaactttcagattgag
gtacagaagggccgctacagcctgcatggctctatggaccactttcccagcctgcgagac
ctcatgaaccacctcaagaagcagatcctgcgcacggacaacataagctttgtgctgaaa
cgatgctgccagcctaagcctcgagaaatctccaatctgctcgtagccactaagaaagcc
caggagtggcagcctgtctactccatgagccagctgagctttgatcggatccttaagaaa
gatattatacaaggtgagcaccttggcagaggcacaagaacacatatctattctgggacc
ctgctggactacaaggatgaggaaggaattgctgaagagaagaagataaaagtgatcctc
aaagtcctagaccccagccaccgggacatttctctggccttctttgaggcagctagcatg
atgagacaagtttctcataaacacattgtgtacctctacggcgtgtgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggagggggggccattggatctcttcatgcaccgg
aaaagtgatgtgcttactaccccctggaagttcaaggttgccaaacagctggccagtgcc
ctgagttacttggaagataaagacctggtccatggaaatgtgtgcactaaaaacctgctt
ctggcccgagagggcattgacagtgacattggcccgttcatcaagcttagtgaccctggc
atcccagtctctgtgctgaccaggcaagagtgcatagagcgaatcccctggatcgctcct
gagtgtgttgaagactccaagaacctgagtgtggctgctgacaagtggagctttggcacc
acactctgggaaatctgctacaatggagagattcctctcaaagacaagaccctcattgag
aaagagaggttttatgaaagccgctgcaggcctgtgactccatcttgcaaggagctagct
gacctcatgactcgctgcatgaactatgatcccaaccagagacccttcttccgagccatc
atgagggacattaacaagctggaggagcagaatccagacattgtttcagaaaagcagcca
acaacagaggtggaccccactcactttgaaaagcggttcctgaaaaggattcgtgacttg
ggagagggtcactttgggaaggttgagctctgcagatatgatcctgagggagacaacaca
ggggaacaggtagctgtcaagtccctgaagcctgagagtggaggtaaccacatagctgat
ctgaagaaggagatagagatcttacggaacctgtaccatgagaacattgtgaagtacaaa
ggaatctgcatggaagacggaggcaatggtatcaagctcatcatggagtttctgccttcg
gggagcctaaaggaatatctgccaaagaataagaacaaaatcaacctcaaacagcagcta
aaatacgccatccagatttgtaaggggatggactatttgggttctcggcaatacgttcac
cgggacttagcagcaagaaatgtccttgttgagagtgagcatcaagtgaagatcggagac
tttggtttaaccaaagcaattgaaaccgataaggagtactacacagtcaaggacgaccgg
gacagcccagtgttctggtacgctccggaatgtttaatccagtgtaaattttatatcgcc
tctgatgtctggtcttttggagtgacactgcacgagctgctcacttactgtgactcagat
tttagtcctatggccttgttcctgaaaatgataggcccaactcatggccagatgacagta
acgcggcttgtgaatactctgaaagaagggaagcgtctgccatgtccacccaactgtcct
gatgaggtttatcagctcatgagaaaatgctgggaattccaaccatctaaccggactact
tttcagagcctcattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system