KEGG   Mus caroli (Ryukyu mouse): 110292253
Entry
110292253         CDS       T05910                                 

Gene name
Patj
Definition
(RefSeq) inaD-like protein isoform X1
  KO
K06092  InaD-like protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04390  Hippo signaling pathway
mcal04530  Tight junction
mcal05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110292253 (Patj)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110292253 (Patj)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110292253 (Patj)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 L27_2
Other DBs
NCBI-GeneID: 110292253
NCBI-ProteinID: XP_021015111
Ensembl: MGP_CAROLIEiJ_G0026184
UniProt: A0A6P7QTS3
LinkDB
Position
4
AA seq 1834 aa
MPENPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQL
KGQLSHIPSDCSANFDFSRKGLLVFTDGSITNGNTHRPCSNVTASELLPWTQKSGSEDFN
SVIQQMAQGRHVEYIDIERPSTGGLGFSVVALRSRSLRLIDIFVKEVHPGSAADRDHRLK
ENDQILAINDTPLDQNISHQQAIALLQQDSGSLRLVVAREVGHTQGRASTSSADTTLPES
VCWGHTEEVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPVGEIAVTPPTPVSLPVALPAVATRTLDSDRSP
FETYNVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAYHNGQIQVNDKIVA
VDGVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSLSASPVEHSSSRETVAEPPEPPERT
ASPKPETNLSVEAEEIGERLDNLKNNTVQALEKPDVYPEKVPGSPENELKSRWENLLGPD
YEVMVATLDTQIADDEELQKYSKLLPIHTLRLGMEVDSFDGHHYISSVAPGGPVDTLNLL
QPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTMEPALLE
AEVDHNVDVNTEDDDDGELALWSPEVKTVELVKDCKGLGFSILDYQDPLDPTRSVIVIRS
LVADGVAERSGELLPGDRLVSVNEFSLDNATLAEAVEVLKAVPPGVVHLGICKPLVEDEK
EEHFSLHSNNNGDNSEPPETVHEIHSSLILEAPQGFRDEPYLEELVDEPFLDLGKSLQFQ
QKDMGSSSEAWEMHEFLSPPMEGRGEEREMLVDEEYELYQDHLRAMESNPPPPHIREAAP
ASPMLELQAGTQWLHANLSGGEMLECHDAESMMSAYPQEMQQYSYSTADMMEETFGLDSR
PPIPSSEGNGQHGRFDDMEHLHSLTSSSLDLGMMIPSDLQGPGVLVDLPAVAQRREQEDL
PLYRLPSTHVVTKPTSHMGLVSSRHANAACELPEREEGEGEETPNFSHWGPPRIVEIFRE
PNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTKALKTGDKILEVSGVDLQ
NASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPTVNNKGKTPATNQDQNTQERKAKRHGT
APPPMKLPPPYRAPSADMEEREEDCALTDKKIRQRYADLPGELHIIELEKDKNGLGLSLA
GNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPTRV
KLVFIRNEDAVSQMAVTPFPELSHSPSPVEDLGGTEPVSSEEESSVDAKHLPAPESSKPE
DLSQVVDDNMVAEQQKASESPDSAACQIKQQTYSTQVSSSSQDIPSSPTPLCQSAHADVT
GSGNFQATLPVDPAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLDAIVIH
EVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVVYRDEAQYRD
EENLEVFLVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNG
EDLRHASQETVATILKCVQGLVQLEIGRLRAGSWAASRKTSQNSQGDQHSAHSSCRPSFA
PVITSLQNLVGTKRSSDPPQKCTEEEPRTVEIIRELCDALGISIAGGKGSPLGDIPIFIA
MIQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQVVADTNISAI
ATQLEIMSAGSQLGSPTADRHPEDPEEQMQRTAD
NT seq 5505 nt   +upstreamnt  +downstreamnt
atgcctgaaaaccctgctgcagagaaaatgcaggtcctgcaggtcctggatcgcctgaga
gggaagctgcaggagaagggagacacgacgcagaacgagaagctgtctgcgttttacgag
accctgaagagccccctcttcaaccagatccttacactgcagcagtccatcaagcagctg
aagggacagcttagccacatcccctcagattgctcagccaactttgacttttctcgcaag
ggcttgctagtgttcacagatggttccattacaaacgggaatacccacaggccttgtagt
aatgtgactgcatctgaattgttgccctggactcaaaagtcaggaagtgaagactttaac
tcagtcattcagcagatggctcagggccggcacgttgagtatatagatattgagcgtcct
tccactggaggccttgggttcagtgtggtggctctgagaagccgaagcctgcgattaatt
gatatctttgtgaaggaagtccatcccgggagtgcagcagacagggatcacagattgaag
gaaaatgaccagattttggccattaatgacaccccattggatcagaatatttcccatcag
caggcgattgcattactacaacaagactctggatctctgcggctggttgtggccagggaa
gtgggccacacacagggccgagcatccaccagctcagctgatacaactctgccagaatcg
gtgtgttggggccacacggaagaggttgagctcattaacgatggctctggattaggtttt
gggatagttggagggaaatccagcggcgtggtcgtgaggactattgttcctggaggactg
gcagaccgagatggaagactgcagacaggggatcacatcttgaagattggtggtacaaat
gttcaaggaatgaccagtgaacaagttgctcaagtgctaaggaactgtgggaattcagtg
aggatgctggtggccagagaccctgtgggtgaaattgcagtaacacctcctacccctgta
tccttacctgttgccctacctgctgtagccacaaggacccttgattctgacaggtctcct
tttgaaacttacaatgttgaacttgttaagaaagatgggcagagtcttgggattagaatt
gttggctatgttggaacagctcatccaggggaagcttccgggatttatgtgaaaagtata
attccaggcagcgctgcctaccacaatggccaaattcaagtgaatgataaaatcgtggct
gtggatggtgtgaatattcagggttttgctaatcaggatgttgttgaagtattgcggaat
gctgggcaggtggtacacctgacccttgttcgaaggaaaacatctttatctgcttctccg
gttgagcactcttcaagcagagaaactgttgcagaaccaccagaaccaccagaacgaaca
gcatccccaaaaccagaaactaatttgagtgtggaagcagaggaaatcggagaaagactg
gataatctaaaaaacaacactgtacaagccttagaaaaaccagatgtatatccagaaaaa
gttccaggctctccagaaaatgagctgaaatccagatgggaaaacctactgggcccagat
tatgaagtaatggtagccactttggacactcagattgcagatgatgaggagctacagaag
tactcgaagctgctgcctatccacacgctcaggcttggtatggaagtcgactccttcgac
gggcaccactatatctcctcagtcgctcctgggggtcctgtggataccctgaacctcctt
cagccagaggatgaacttcttgaggtcaacggcatgcagctttatgggaagtctcgccga
gaagcagtctccttccttaaagaagtgcccccaccatttaccttggtctgctgccgccgg
ctgtttgatgatgaggcctcagttgatgagccaagaaccatggagcctgctcttcttgag
gccgaggttgaccacaatgtagatgtcaacactgaagatgatgatgatggagaattagcc
ctgtggtctcctgaagtcaagactgtggagctggtgaaagactgcaaaggcttaggattc
agtattttggattatcaggaccccctggatcccacgcgctcagtgattgtgattcgctcc
ttggtggcagatggtgtagcggaaagaagtggagaacttttacctggagatcgcctagtc
tccgtcaatgagttctccttggacaatgccactcttgctgaggctgtggaagtgctgaag
gctgtaccccccggtgtggtgcacctcggcatctgtaagcctttggtggaagatgagaag
gaagaacattttagtttacattctaacaacaatggtgacaacagcgagcctccagagact
gttcatgagatccactcgtctttaatccttgaggcaccccagggatttagagatgagcca
tatcttgaagaactcgtggatgaaccttttctagatttgggaaagtctttgcagttccaa
caaaaagacatgggcagcagctcggaagcctgggaaatgcatgagttcctgagccctcca
atggagggcaggggtgaggaaagagaaatgcttgtcgatgaggagtatgaactttatcaa
gatcacctccgggccatggagtcaaacccaccaccaccacacattcgggaggccgctcct
gcatctcccatgctggaactccaggctggcacccagtggctgcatgctaacctctcagga
ggcgaaatgctagagtgtcacgatgcagagtccatgatgagtgcctatccccaggagatg
cagcagtatagctacagcactgcagacatgatggaagaaacgtttggccttgattcccgg
ccccccataccgtcctctgaaggaaatggtcaacatggcagatttgatgacatggaacac
cttcattcactaacgagcagcagcctggatttaggcatgatgattccaagtgatctgcaa
ggtcctggcgtgcttgttgatcttccagctgttgctcaaagaagagaacaggaagatttg
cctctgtaccgactccccagcacccacgttgtcaccaagcccacatcacacatgggactg
gtgtcttcacggcatgcaaatgctgcatgtgaattaccggagagagaggaaggagaagga
gaggagacaccgaacttcagccactggggtccaccaagaattgttgaaatttttagagaa
cctaatgtgtctcttggcatcagcatcgttggtggacagacagttataaaacgcctcaag
aatggagaggagctcaaggggatattcatcaaacaagtgttagaggacagtcctgcaggg
aagaccaaggcgctgaaaaccggagataaaattcttgaggtgtctggtgtagacctgcag
aacgcctcgcatgcagaagccgtggaggcaatcaagagtgcgggaaaccctgtggtgttc
gtggtacagagcctgtcatccactccaagggtcatcccaactgtgaataacaaaggcaaa
acacctgccactaaccaggatcaaaacactcaagaaaggaaagctaagaggcacggaaca
gctccacctccaatgaagctgcccccgccttacagagctccatctgcagacatggaggaa
cgtgaagaagactgtgcgctgaccgacaaaaagatcaggcaacgatatgcagacctgccg
ggagaattacacattatcgaactggaaaaggacaagaatggactggggctcagtcttgct
ggcaataaggacaggtcacggatgagcatcttcgtggtggggattaatccagagggacct
gctgctgcagatggacggatgcggattggagacgagctgctagagataaacaatcagatt
ctttatggaagaagtcatcagaacgcatctgccattattaagaccgccccaaccagggtc
aaactggttttcattagaaacgaagatgcagtcagtcagatggccgtcactcccttcccg
gagctatcacattccccatcgcctgttgaggatctgggtggcactgaacctgtcagtagt
gaagaggagagcagtgtggatgctaaacacctgcctgcaccagaaagctccaaaccggaa
gacctgtcccaggtggttgatgacaacatggtggcagagcagcagaaggcatcggagtca
cctgacagtgctgcctgccagataaaacagcagacatattcaacacaagtctcctccagc
tcacaagatatcccatcatcaccaactccattgtgtcagtcagcacatgcagatgtcaca
ggctctggtaacttccaggctactctcccagtggaccctgctccactctcggtggaccct
gcaacatgtcccatcgtccctggccaggaaatgatcatagaaatatccaaggggcgctcc
gggcttgggctcagcattgttggaggaaaagacacacctttggatgctatagttatccat
gaagtctatgaagaaggtgcagctgccagagatggaagattatgggctggagaccagata
ttagaggttaatggggttgatctgcggagctccagccatgaagaagccatcacagccctg
aggcagactccccagaaggtgcggctggtggtatacagagatgaagcacagtacagagac
gaggagaacttggaggtgttccttgtggacctgcagaagaagactggccgaggactaggc
ctgagcattgttgggaaacggagtggaagtggagtgtttatttctgacattgtgaaaggc
ggggccgcagacctcgatggaaggttaattcgaggagaccagatcttgtctgtgaatgga
gaggacttgagacacgcctcacaagagacagtggccaccatcctgaagtgtgtccagggc
cttgtccagctggagattgggagactccgcgccggttcctgggccgcctcgaggaagacc
tcgcagaacagccagggggatcagcacagtgcacacagcagctgtcggccttcctttgcc
ccggtcatcaccagcctacaaaacctggttggcacaaaacgatcttcagatcctccccag
aaatgcacagaggaggaaccaaggactgtagagataatcagagagctctgcgatgccctt
gggatcagtatcgctggaggaaaggggagtcctttaggagatatccccatatttattgcc
atgattcaggccaacggagtggccgcacggacccagaagcttaaggttggagatcggatt
gtgagcattaatggacaacctctggatggactgtctcacacagatgccgttaatctactg
aagaatgccttcgggcgcattatcctgcaggttgtggcagataccaacataagtgccata
gcgacccagctggaaatcatgtctgcaggctcccagcttggctccccgactgctgaccga
catccggaagacccagaggagcagatgcagaggacggctgattaa

DBGET integrated database retrieval system