KEGG   Mus caroli (Ryukyu mouse): 110292264
Entry
110292264         CDS       T05910                                 

Gene name
Dvl1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04330  Notch signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110292264 (Dvl1)
   04330 Notch signaling pathway
    110292264 (Dvl1)
   04390 Hippo signaling pathway
    110292264 (Dvl1)
   04150 mTOR signaling pathway
    110292264 (Dvl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110292264 (Dvl1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110292264 (Dvl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292264 (Dvl1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110292264 (Dvl1)
   05226 Gastric cancer
    110292264 (Dvl1)
   05217 Basal cell carcinoma
    110292264 (Dvl1)
   05224 Breast cancer
    110292264 (Dvl1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110292264 (Dvl1)
   05022 Pathways of neurodegeneration - multiple diseases
    110292264 (Dvl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110292264 (Dvl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110292264 (Dvl1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 110292264
NCBI-ProteinID: XP_021015134
Ensembl: MGP_CAROLIEiJ_G0026908
UniProt: A0A6P5PCN7
LinkDB
Position
4
AA seq 709 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKCRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPRSRCEPGLREVCSAELEE
APLTVKSDMSAIVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERRE
ARKYASSMLKHGFLRHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLP
HPSVPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRTP
GREERRATGTGGSGSESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHP
LTKAYAVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcggagactaaaatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtagctcccgagcgcgtcacgctggcagacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtctatggaccaggacttcggggtggtgaag
gaggagatcttcgatgacaatgccaagttgccctgcttcaatggccgggtggtttcctgg
ctggtcctggctgagggcgctcactcggatgcagggtcccagggcactgacagccacacg
gacctgcccccaccccttgagaggacaggcggcattggggactccaggcccccctccttc
catcctaatgttgccagtagccgggacggaatggacaatgagacaggcacagagtctatg
gtcagtcaccggcgggagcgagccagacgtcgaaaccgcgatgaggctgcccggaccaat
gggcacccgagaggggatcggcggcgggacctggggctacctccagacagtgcatccact
gtactgagcagtgagcttgaatctagcagctttattgactcagatgaggaggacaataca
agccggctgagcagctccacagagcagagcacctcctctcggctaattcgtaagcacaaa
tgccggcgtcggaagcagcgcttgaggcagacagaccgggcatcctccttcagcagcatc
acagactccaccatgtccctgaacatcatcaccgtcactctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgatggcggcatctacatt
ggatccatcatgaagggcggggccgtggctgctgatggccgcattgagccgggcgacatg
ttgctgcaggtgaatgatgtcaactttgagaacatgagcaatgatgatgctgtacgggtg
cttcgggagatcgtatcccagacagggcccatcagtctcacagtggccaagtgctgggac
ccaacccctcggagctacttcaccatcccaagggctgacccagtgcgacccatcgacccg
gctgcctggctgtcccacacagcagcactgacgggtgctctgccccgctatggtacgagt
ccctgctccagcgccatcacacgcaccagctcttcctcactaaccagctcagtgcctggc
gccccacgttcacgctgtgagcctgggctcagagaagtgtgctctgcagagcttgaggag
gcaccgctgactgtgaagagtgacatgagtgccattgtccgcgtcatgcagttgccagac
tcaggactggagatccgggaccgcatgtggcttaagatcaccattgctaatgctgtcatt
ggggcggatgtggtggactggctgtacacacacgtggagggcttcaaggagcgaagggag
gcaaggaagtatgccagcagtatgctgaagcatggtttcctgaggcacaccgtgaacaag
atcaccttctctgagcaatgctactatgtctttggtgacctgtgcagtaacctcgcatcc
ctgaacctcaacagtggctccagtggagcctcagatcaggacacactggccccactgccc
cacccatcagtaccctggcccttgggtcaaggctacccctaccagtacccaggaccccca
ccctgcttcccacctgcttaccaggaccctggcttcagctatggcagtggcagtgctggg
agccagcagagtgaagggagcaagagcagtgggtccacaaggagcagccatcggacccca
ggccgagaggagcgccgggcaactggaactgggggtagtggcagtgaatcagaccacaca
gtaccaagtgggtctggtagcaccggctggtgggagcggcctgtcagccagcttagccgt
ggcagtagtcctcgaagtcaggcttcagctgttgccccagggctccctccactgcacccc
cttacaaaggcctatgcagtagtgggtgggccacctggagggccacctgtccgggagctg
gctgctgttcctccagaacttacaggtagccgccaatccttccaaaaggccatgggaaac
ccctgtgagttctttgtggacatcatgtga

KEGG   Mus caroli (Ryukyu mouse): 110304161
Entry
110304161         CDS       T05910                                 

Gene name
Dvl2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2
  KO
K02353  segment polarity protein dishevelled
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04330  Notch signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110304161 (Dvl2)
   04330 Notch signaling pathway
    110304161 (Dvl2)
   04390 Hippo signaling pathway
    110304161 (Dvl2)
   04150 mTOR signaling pathway
    110304161 (Dvl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110304161 (Dvl2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110304161 (Dvl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110304161 (Dvl2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110304161 (Dvl2)
   05226 Gastric cancer
    110304161 (Dvl2)
   05217 Basal cell carcinoma
    110304161 (Dvl2)
   05224 Breast cancer
    110304161 (Dvl2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110304161 (Dvl2)
   05022 Pathways of neurodegeneration - multiple diseases
    110304161 (Dvl2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110304161 (Dvl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110304161 (Dvl2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 110304161
NCBI-ProteinID: XP_021031055
Ensembl: MGP_CAROLIEiJ_G0016613
UniProt: A0A6P5QDD6
LinkDB
Position
11
AA seq 736 aa
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDTSQPEAAPPAHESRTELVPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGAGGHRPG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRMERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
MDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESELSSRGGSLRRGGEPGGTGDGGPPPSRGSAGAPPNLRA
LPGLHPYGAPSGMALPYNPMMVVMMPPPPPPVSTAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcagcgcggggggcggtggtgtaggcgagacgaaggtgatttaccatctg
gatgaagaagagactccttacctagtgaagatccctgtcccggcggagcgcatcacgctc
ggcgatttcaagagcgttttgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggattttggggtggtgaaggaagagatctccgatgacaatgcccgcctaccttgc
ttcaatggaagggttgtctcctggcttgtgtcgtcagatacctcccagcctgaggcggct
cccccagcccatgagtctcggacagaactggttcctccacctccaccgttaccccctttg
ccaccagaaaggaccagtggaattggggactcaaggcctccgtccttccaccctaatgta
tccagcagccatgaaaatctagagcctgagacagagaccgaatctgttgtatcactgagg
cgagaccgaccgaggaggagagacagcagtgaacatggcgctggtggccacaggcctggt
ggcccctcaaggctggagcgccacctggctgggtacgagagctcttccaccctcatgacc
agtgagctggagagtaccagcctaggagactcggatgaggatgacaccatgagtaggttc
agcagctccactgagcagagcagtgcctcccgcctcctcaagcgccaccgaaggcgaagg
aaacagcggccgccacgcatggagaggacctcatccttcagcagcgtcaccgattccaca
atgtctcttaacatcatcacggtcacactcaacatggagaagtacaacttcctgggcatc
tccattgtgggccaaagtaatgagcgtggtgacgggggcatctacatcggctctatcatg
aaagggggcgcggtggctgcggacgggcggatcgagcctggagacatgcttttgcaggta
aatgatatgaactttgagaacatgagcaacgatgatgctgttcgggtgctgagagacatc
gtgcacaagccaggccccatcgtgctgaccgtggccaagtgttgggacccgtctccccag
gcctacttcaccctccctcgaaatgagcccatccagcccattgacccagccgcctgggtg
tcgcactcggctgcgctgaccggcgccttccctgcttaccccggctcctcatctatgagc
actatcacatctggctcctctctgcctgatggctgtgaaggccggggtctctctgtccac
atggacatggcctctgtcaccaaggccatggcagccccagagtctgggctcgaagtccgg
gaccgcatgtggctcaagatcaccatcccaaacgcctttctaggctccgatgtggtagac
tggctgtatcatcatgtggaaggttttcctgagcgccgggaggcccgcaagtacgccagt
gggctgttgaaggcgggactcatccggcacaccgtcaacaagattactttctctgagcag
tgctattatgtcttcggggacctcagtggtggctgtgagagttacctagttaacctgtct
ctgaatgacaatgacggttccagtggggcttcagaccaggataccctggcacctctgcct
ggagctactccctggcccctgctgcccaccttctcctaccagtatccagcgccacacccc
tacagcccccagcctccaccctaccacgagctttcttcgtacacctatggtggaggcagt
gccagcagccagcacagtgaggggagccggagcagtgggtcgacaagaagcgatgggggg
gctgggcgcacaggcaggcctgaggaacgggcccctgagtccaagtccggcagtggcagt
gagtcagaactctccagccggggaggcagccttcggcggggtggggagcctggtgggact
ggtgatggtggcccccctccatctaggggctcggcaggcgctcctcctaatctccgagct
cttcccgggctccatccctatggagccccatctggcatggctctcccttataaccccatg
atggtagttatgatgcctccacccccaccccctgtctccacagcagtgcagccccctggt
gcccctccagtcagagacctgggctccgtgcccccagaactgacagctagccgtcagagc
ttccacatggccatgggcaaccccagtgagttttttgtggatgttatgtag

KEGG   Mus caroli (Ryukyu mouse): 110311604
Entry
110311604         CDS       T05910                                 

Gene name
Dvl3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3
  KO
K02353  segment polarity protein dishevelled
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04150  mTOR signaling pathway
mcal04310  Wnt signaling pathway
mcal04330  Notch signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04916  Melanogenesis
mcal04934  Cushing syndrome
mcal05010  Alzheimer disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110311604 (Dvl3)
   04330 Notch signaling pathway
    110311604 (Dvl3)
   04390 Hippo signaling pathway
    110311604 (Dvl3)
   04150 mTOR signaling pathway
    110311604 (Dvl3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110311604 (Dvl3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110311604 (Dvl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311604 (Dvl3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110311604 (Dvl3)
   05226 Gastric cancer
    110311604 (Dvl3)
   05217 Basal cell carcinoma
    110311604 (Dvl3)
   05224 Breast cancer
    110311604 (Dvl3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110311604 (Dvl3)
   05022 Pathways of neurodegeneration - multiple diseases
    110311604 (Dvl3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110311604 (Dvl3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110311604 (Dvl3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 110311604
NCBI-ProteinID: XP_021040659
Ensembl: MGP_CAROLIEiJ_G0020577
LinkDB
Position
16
AA seq 716 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPSMERTGGIGDSRPPSFHPH
ASGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTTKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLTSSLRSHHTHPSYGPPGVPP
LYGPPMLMMTPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacggccaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcggccc
agctataagttcttcttcaagtctatggacgacgattttggggtggtgaaggaagagatc
tcggacgacaatgccaagctaccttgcttcaatggccgggtggtgtcctggctggtatct
gccgagggctcgcacccagagccggcccctttctgtgctgacaacccgtcagagctgcca
ccttcgatggaacgcacaggaggcattggggactctcgacccccctccttccaccctcat
gctagtgggggcagccaggagaatctggacaatgacacggagaccgactccttggtgtct
gcccaacgagagcggccccgacggagggacggccccgagcacgcggcccgactcaatgga
accacaaagggtgagcggcgacgggagccaggcggctatgacagttcatctacgctcatg
agcagcgagctggagactaccagtttctttgattcagatgaggatgattccaccagcagg
ttcagcagctccacagaacagagcagtgcctcacgcctcatgagaagacacaagcggcgg
cggcggaagcagaaggtctcccggattgagcggtcctcgtctttcagcagcatcacagac
tccactatgtctctcaacatcatcaccgtcactctcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaatgagcgaggtgatggaggcatctacattggctcc
atcatgaagggtggggctgtggcagctgatggacgaattgagccaggagatatgctactg
caggtaaatgagatcaacttcgagaacatgagcaatgatgacgcagtccgagtccttcgg
gagattgtgcacaagccagggcccatcactctgactgtagccaagtgctgggatccaagt
cctcgcggctgcttcacattaccccggagcgagcccatccgtcccattgaccctgcagcc
tgggtctctcacacggcagccatgacaggcaccttccccgcctatggcatgagcccctcc
ttaagcaccatcacctctaccagctcctccatcaccagctccatccctgatacagagcgc
ctagatgatttccacctctccatccacagtgacatggcggccatcgtaaaagccatggcc
tcccctgagtcagggttggaggtccgagaccgcatgtggctcaagattaccattcccaat
gctttcatcggctcggatgtggtagactggctgtaccacaacgtggaagggttcaccgac
cgtcgggaggcccgcaagtacgctagcaacctgctgaaggctggcttcatccgccatacc
gtcaacaagatcaccttctccgagcagtgctactacatctttggcgacctctgtggtaac
atggccaacctatcgcttcacgaccatgatggctccagtggcgcctctgaccaggacaca
ctggctcctttgccgcacccaggagctgccccttggcctatggctttcccttaccagtat
ccaccacctccgcatccctacaacccacacccaggcttcccagaactgggctacagctac
ggtgggggcagcgccagcagtcagcacagtgaaggcagtcggagcagtggctccaaccga
agtggcagcgaccggcgcaaggagaaggacccaaaagctggggactccaagtcaggtggt
agcggcagtgagtcagaccacactacacgcagcagtctgagggggccacgggagcgggca
ccaagcgagcgatcaggcccagcggccagcgagcacagccaccgcagtcaccattcactg
accagcagcctgcgcagccaccacacacacccaagctatggcccacccggagtgccccct
ctctatggtcccccgatgctgatgatgaccccgccgccggcagccatggggcccccagga
gcccctccagggcgtgacctggcctcggtgcccccggaactgacggccagcagacagtcc
ttccgcatggcaatgggaaaccccagtgagttctttgtggatgtgatgtga

DBGET integrated database retrieval system