KEGG   Mus caroli (Ryukyu mouse): 110292269
Entry
110292269         CDS       T05910                                 

Gene name
Cacna1e
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110292269 (Cacna1e)
   04020 Calcium signaling pathway
    110292269 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110292269 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110292269 (Cacna1e)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110292269 (Cacna1e)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 110292269
NCBI-ProteinID: XP_021015151
Ensembl: MGP_CAROLIEiJ_G0014720
LinkDB
Position
1
AA seq 2316 aa
MARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVR
QNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTP
MSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTH
FNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIG
LEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAV
LTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERE
RVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSR
TEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFY
WIVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSS
FNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSS
MKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDW
NEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEE
EEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWE
QRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALG
LGLEKCEEERISRGGSLKGDIGGLTSALDNQRSPLSLGKREPPWLPRSCHGNCDPTQQEA
GGGETVVTFEDRARHRQSQRRSRHRRVRTEGKESASASRSRSASQERSLDEGVSIEGEKE
HEPHSSHRSKEPTIHEEERTQDLRRTNSLMVPRGSGLGGALDEAETPLVQPQPELEVGKD
AALTEQEAEGSSEQALLGDVQLDVGRGISQSEPDLSCMTANMDKATTESTSVTVAIPDVD
PLVDSTVVNISNKTDGEASPLKEAETKEEEEEAEKKKKQKKEKRETGKAMVPHSSMFIFS
TTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVF
TFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSL
RVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFY
CTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQV
LQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEC
SLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMM
KYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEI
ILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAML
FFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKG
CEPDTTAPSGQNESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILG
PHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPV
AEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPM
PKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKA
LPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQ
SSNHGIYLPPDTQEHAGSGRASSMPRLTMDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEF
SMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDV
SRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRR
QLPPVPPKPRPLLSYSSLMRHTGGISPPPDGSEGGSPLASQALESNSACLTESSNSLHPQ
QGQHPSPQHYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQ
MPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6951 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgttggcaggccaggctcaggcgatggagactcg
gaccagagcaggaaccgacaaggaacccccgtcccggcctcggggccggcggccgcctac
aagcagtcaaaagcgcagagggcgcggactatggctttgtacaaccccataccagtccgg
cagaactgtttcacggtcaacagatccctgttcatcttcggagaagataacattgtcagg
aaatacgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatc
attgccaactgcatcgtcttggccctggagcagcatcttcctgaggatgacaagacccca
atgtctcgaagactggagaagacagaaccatatttcattgggatcttctgctttgaagct
gggatcaaaattgtggctctagggttcatcttccataagggttcatacctccgtaatggc
tggaatgtcatggacttcatcgtggtccttagtggtatcctggccactgcgggaacccac
ttcaacacccacgtggacctgcggaccctccgggctgtgcgtgtcctgaggcctttaaag
ctggtatcaggaatacctagcctgcaaatcgtgctgaagtctatcatgaaggccatggtg
cctcttctgcagattggccttctgctcttctttgccatcctcatgtttgctatcattggc
ttggagttctacagtggcaagttgcatcgagcgtgcttcatgaacaattcaggtattcta
gaggggtttgatccccctcacccgtgtggtgtgcagggctgcccggctggttatgaatgt
aaggactggatcggccccaatgacgggatcacccagtttgacaacatcctttttgccgtg
ctgactgtcttccaatgcatcactatggaagggtggaccactgtgctgtacaataccaat
gatgccttaggagccacctggaactggctgtacttcatccccctcatcatcatcggatcc
ttcttcgttctcaacctcgtcctgggagtgctttccggggaatttgccaaagaaagagag
agagtggagaaccgaagagcattcatgaagctccggcgccagcaacagattgagcgagaa
ttgaatggctaccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaat
aaaaactcgggaacatcagccttggaagtgcttcgaagggcaaccatcaaaaggagccgg
acggaggccatgacccgagactccagcgatgagcactgcgttgatatctcttcagtgggc
acacctcttgccagagccagtatcaagagcacaaaagtagacggagcctcctatttccgg
cacaaggaacggcttctgcgcatctctatccgccacatggtcaagtcccaagtcttttac
tggatcgtcctgagtgttgtggctcttaatactgcctgtgtggccattgttcatcacaac
cagccacaatggctcactcacctcctctactatgcagagtttttgtttctgggactcttc
ctgttggagatgtccctgaagatgtatggcatggggccacgcctctattttcactcatcc
ttcaactgctttgattttggggtcacagtgggcagcatctttgaggttgtctgggcaatc
ttcagacctggcacatctttcggaatcagtgtcttacgagctctccggctcctaaggata
tttaaaataaccaagtattgggcatccctccggaatctggttgtctccttgatgagctcc
atgaagtctatcatcagcttactcttcctcctcttcctcttcatcgttgtctttgctctc
ctgggaatgcagctctttggaggcaggtttaactttaatgatgggactccttcagctaat
tttgacaccttccctgcagctatcatgacagtgttccagatcctgaccggggaagactgg
aatgaggtgatgtacaatggcattcgctcccagggtggggtcagctcaggcatgtggtct
gccatctacttcattgtgctcaccttgtttggaaactacacgctgctgaatgtattcttg
gccattgctgtggataatctggccaatgcccaggaactgaccaaggatgagcaggaggaa
gaagaagccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtct
gctcccaacatgccttccattgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggaa
cagcgcaccagccagctgaggaggcacatgcaaatgtctagccaagaagccctcaacaaa
gaggaggccccgccaatgaaccccctcaatccactcaacccactgagtcctctcaacccc
ctcaatgctcaccccagcctctatcggaggcccaggcccattgagggtctagccctgggt
ctgggtcttgaaaagtgtgaagaggaacgcatcagtcgtgggggctccctcaaaggggac
atagggggcctgactagcgccctggacaaccagaggagccccttgtccttgggcaaacgg
gagccaccgtggctgcctagatcctgtcatggaaactgtgacccaacccagcaggaggct
gggggaggagagactgtggtgacttttgaggatcgggccaggcacaggcagagtcagagg
cgaagccggcatcgccgagtcagaactgagggcaaggagtctgcctctgcctcccgaagc
aggtctgccagccaagagcggagtctggatgaaggggtgtccattgagggggagaaggag
catgagcctcacagcagccacaggagcaaagagccgaccatccatgaagaggagagaacc
caggacttaaggaggaccaacagtctgatggtacccaggggctctggactgggaggggct
cttgatgaagcagaaacacctctagtccagccccaacctgagctggaagtggggaaggat
gcagctctgacagagcaggaggctgaaggcagcagtgaacaagcccttcttggggacgta
cagctggatgtgggccggggcattagccagagtgaaccagatctttcctgcatgacagcc
aacatggacaaggctaccacggagagcaccagtgtcacggtcgccatccctgatgtggac
cccttggtggactcaacagtggtgaacatcagcaacaagacggatggagaagccagtccc
ttgaaggaggcagagactaaagaggaagaagaagaggcagagaagaagaagaagcagaag
aaggagaagcgggagactggcaaagccatggtgccccatagctctatgttcatcttcagc
accactaatccgatccgcagggcctgccactacattgtgaacctccgctactttgaaatg
tgcattctcttggtgattgcggccagcagcattgccctggcagccgaggaccctgtacta
actaactcggagcgtaacaaagtcctgagatatttcgactatgttttcacgggagtgttt
acctttgaaatggttataaagatgatagaccaaggcttgatccttcaggatggatcatac
ttccgagacctctggaacatcctggactttgtggtagtggttggtgcattggttgcattt
gctctggcgaacgctttgggaaccaacaaggggagggatatcaagactatcaagtctctg
agggtgcttcgagttctgaggccactgaaaaccatcaagcgcttgcccaagctgaaggct
gtgtttgactgcgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaag
ctcttcatgttcatctttgccgtcatcgctgttcagctattcaaaggaaagttcttttat
tgcactgacagttccaaggacacagagaaggagtgcataggcaactatgtagaccatgag
aaaaacaagatggaggtaaagggccgggaatggaagcgtcatgaattccactatgacaac
atcatctgggccctgcttaccctcttcaccgtctcaacgggggaaggatggcctcaggtt
ctacagcactctgtagatgtgacagaggaggacagaggcccaagtcgcagcaaccgtatg
gagatgtccatcttttatgtggtctactttgtggtcttccctttcttctttgtcaatatc
ttcgtggctctcattatcatcaccttccaggagcaaggggacaagatgatggaggaatgt
agcctggagaagaatgagcgggcatgcattgacttcgccattagtgccaagcctctcacc
cgctacatgccacagaacagacacaccttccagtaccgtgtgtggcactttgtagtctcc
ccatcctttgagtataccatcatggccatgattgccttgaacactgtcgtgctgatgatg
aagtactactctgctccttgcacctatgagctcgccctaaagtacctgaacatcgccttc
actatggtgttttccctggagtgtgtcctaaaggtcatcgctttcggcttcctgaactac
ttccgagatacctggaacatctttgacttcatcacggtgatcggcagtatcacagaaatt
atcctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctc
ttccgagctgcacggctcataaagcttctgagacagggctacaccatccgcatcttactg
tggaccttcgtgcagtcctttaaggctcttccttatgtctgccttctgattgccatgctt
ttcttcatctacgccatcattgggatgcaggtgtttggaaacatcaagttagatgaggag
agtcacatcaaccggcacaacaacttccggagtttctttgggtccctcatgctgcttttc
aggagtgccacaggggaggcttggcaggagattatgctgtcctgtctcggtgagaagggc
tgcgagcctgacaccaccgcaccctcagggcagaatgagagtgagcgctgtggcaccgac
ctggcctacgtttattttgtctccttcatcttcttctgctccttcctgatgctcaacctg
ttcgtggctgtcatcatggacaactttgagtacctgactcgagattcctccatcctgggg
cctcaccacttagatgaatttgtccgtgtctgggcagaatatgacagagcagcatgtggc
cgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctc
ggcaagagatgtccctccaaagtggcctataagaggttggtcctgatgaacatgccagtg
gctgaggacatgacagtccacttcacctccacacttatggctctgatccggacagctctg
gacattaaaatcgccaaaggtggtgcagacagacagcagctagactcagagcttcaaaaa
gagaccctggccatttggcctcacctgtcccaaaagatgttggatctgctagtgcccatg
cccaaagcctctgacctgactgtgggcaagatctatgcagcaatgatgatcatggactac
tataaacagagtaaggtaaagaaacagagacagcagctggaagaacagaaaaatgcaccc
atgttccagcgcatggagccctcatcactgcctcaggagatcattgctaatgccaaagcc
ctgccttatctccagcaggaccctgtttctggcctgagtggtcggagtggatacccttca
atgagtccactctcccctcaagaaatattccagttggcttgtatggacccagcggatgat
gggcaattccaggaacaacaatctctggagccagaggttagtgaattaaaaagtgtgcag
tcctctaaccatggcatctaccttcctccggacacccaggagcatgcgggatctgggagg
gcatcctctatgccacgtctgactatggatccccaggtggtaacagaccctagctctatg
cgacgttcattttctacaattcgggataagcgttcaaattcctcctggttggaggagttc
tccatggaacgcagcagtgaaaacacttacaagtcacggcgcagaagttaccactcctcc
ctgaggctgtcagcacaccgcctgaattctgactccggtcacaagtctgacactcaccgc
tcaggaggcagggagagaggccgatccaaagaacgaaagcacctcctctctccggatgtc
tcccgctgcaattctgaggagcgagggacccaggctgactgggagtccccagaacgtcgc
cagtccaggtcacccagtgaaggaaggtcacagacccccaacagacagggtactggttcc
ctaagtgagagctccatcccctctatttccgacaccagcaccccaagacgaagccgtcgc
cagctcccacctgtgccaccaaagcctcgtcccctcctctcctacagctccctgatgaga
cacactggcggcatctctccacctcctgatggaagtgagggtggatccccactggcctct
caagctctggagagcaacagcgcttgcctgaccgagtcttccaactccttgcacccccag
cagggtcagcatccttccccacagcactacatctccgagccctatctggccctccatgaa
gactcccacgcctcagactgtggcgaggaggagacactcacctttgaggcagccgtagcc
actagcttgggccgatccaataccattggctctgcgccacccctacggcacagctggcag
atgcctaatgggcactatcggcggcggaggcgtggggggcctgggcctggcatgatgtgt
ggagctgtcagtgacctcctgagtgacacggaagaagacgataagtgctag

DBGET integrated database retrieval system