KEGG   Mus caroli (Ryukyu mouse): 110292292
Entry
110292292         CDS       T05910                                 

Gene name
Hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04213  Longevity regulating pathway - multiple species
mcal04330  Notch signaling pathway
mcal04613  Neutrophil extracellular trap formation
mcal04919  Thyroid hormone signaling pathway
mcal05016  Huntington disease
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110292292 (Hdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110292292 (Hdac1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    110292292 (Hdac1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110292292 (Hdac1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110292292 (Hdac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292292 (Hdac1)
   05202 Transcriptional misregulation in cancer
    110292292 (Hdac1)
   05206 MicroRNAs in cancer
    110292292 (Hdac1)
   05203 Viral carcinogenesis
    110292292 (Hdac1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110292292 (Hdac1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110292292 (Hdac1)
  09165 Substance dependence
   05031 Amphetamine addiction
    110292292 (Hdac1)
   05034 Alcoholism
    110292292 (Hdac1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110292292 (Hdac1)
   05165 Human papillomavirus infection
    110292292 (Hdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110292292 (Hdac1)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110292292 (Hdac1)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110292292 (Hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     110292292 (Hdac1)
    BRAF-HDAC complex
     110292292 (Hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110292292 (Hdac1)
  Chromatin remodeling factors
   NuRD complex
    110292292 (Hdac1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 110292292
NCBI-ProteinID: XP_021015192
Ensembl: MGP_CAROLIEiJ_G0026523
UniProt: A0A6P5PHI3
LinkDB
Position
4
AA seq 482 aa
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEEEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggacgttgga
aactactattatggacaagggcaccccatgaagcctcaccgaatccgcatgactcacaat
ttgctactcaactatggtctctaccgaaaaatggaaatctatcgtcctcataaagccaat
gccgaggagatgaccaagtaccacagtgatgactacattaagttcctgcgttctattcgc
ccagataatatgtctgaatacagcaagcagatgcagagattcaacgttggtgaggactgt
ccggtatttgatggcttgtttgagttctgtcagttgtccacgggaggctctgtcgcaagt
gctgtgaagcttaataagcagcagacggacatcgctgtgaactgggctgggggcctgcac
catgcaaagaagtccgaagcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatatcgacattgatattcaccatggc
gatggcgtggaagaggccttctatactacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggacattggggctggcaaaggcaag
tactacgctgtgaactacccacttcgagacggcattgacgacgagtcctatgaagccatc
ttcaagccagtcatgtccaaagtaatggagatgttccagcctagtgcagtggtcttacag
tgtggctcagattccctgtctggggatcggttaggttgcttcaatctgaccatcaaagga
cacgccaagtgtgtggagttcgtgaagagtttcaacttgcccatgctgatgctgggagga
ggtggctacaccatccggaatgttgctcggtgctggacttatgaaacagccgttgccttg
gacacagagatccctaatgagctgccctacaacgactactttgagtacttcggaccggat
ttcaagctccacatcagcccttccaacatgaccaaccagaacactaacgagtacctggag
aagatcaagcagcgtctctttgagaacttgaggatgctgccccacgcccctggggtccag
atgcaggccatacctgaggacgccatcccagaagagagtggggatgaggaggaggaggac
cccgacaagcggatctccatctgctcctctgacaaacgcattgcctgtgaggaagagttc
tcggactcagatgaggagggagaaggtggtcgcaagaactcttctaacttcaaaaaagcc
aaaagagttaaaacagaggatgaaaaagagaaagatcctgaagagaaaaaagaagtcaca
gaagaggagaagaccaaggaggagaagccagaagccaaaggggtcaaagaagaggtcaag
ttggcctga

KEGG   Mus caroli (Ryukyu mouse): 110302836
Entry
110302836         CDS       T05910                                 

Gene name
Hdac2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04110  Cell cycle
mcal04213  Longevity regulating pathway - multiple species
mcal04330  Notch signaling pathway
mcal04613  Neutrophil extracellular trap formation
mcal04919  Thyroid hormone signaling pathway
mcal05016  Huntington disease
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05165  Human papillomavirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    110302836 (Hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110302836 (Hdac2)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    110302836 (Hdac2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110302836 (Hdac2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110302836 (Hdac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302836 (Hdac2)
   05202 Transcriptional misregulation in cancer
    110302836 (Hdac2)
   05206 MicroRNAs in cancer
    110302836 (Hdac2)
   05203 Viral carcinogenesis
    110302836 (Hdac2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110302836 (Hdac2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110302836 (Hdac2)
  09165 Substance dependence
   05031 Amphetamine addiction
    110302836 (Hdac2)
   05034 Alcoholism
    110302836 (Hdac2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110302836 (Hdac2)
   05165 Human papillomavirus infection
    110302836 (Hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110302836 (Hdac2)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110302836 (Hdac2)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110302836 (Hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     110302836 (Hdac2)
    BRAF-HDAC complex
     110302836 (Hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110302836 (Hdac2)
  Chromatin remodeling factors
   NuRD complex
    110302836 (Hdac2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 110302836
NCBI-ProteinID: XP_021029253
Ensembl: MGP_CAROLIEiJ_G0015239
UniProt: A0A6P5QFV5
LinkDB
Position
10
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKADTKGA
KSEQLSNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtgtgctactactatgatggtgatatt
ggaaattattattatggccagggtcatcccatgaagcctcatagaatccggatgactcat
aacttgctgctaaattatggtttataccgaaaaatggaaatatataggcctcataaagcc
actgctgaagaaatgactaaataccacagcgatgagtatatcaagtttctacgatcaata
agaccagataacatgtctgagtacagtaagcagatgcagagatttaacgtcggagaagat
tgtccggtgtttgatggactctttgagttttgtcagctctccactggtggttcagttgct
ggggctgtgaaattaaaccggcaacaaactgatatggctgtcaattgggctggaggacta
catcatgccaagaagtcagaagcatcagggttctgctacgttaatgatattgtgcttgcc
atcctcgaattactaaagtatcatcagagagtcttatatattgacatagacatccaccat
ggtgatggtgttgaggaagctttttatacaacagatcgagtgatgaccgtctcattccat
aaatatggagaatactttcctggaacaggagacttgagggatattggtgctggaaaggga
aaatactatgctgtcaattttcccatgagagatggtatagatgatgaatcatatggacaa
atttttaagcctatcatctcaaaagtgatggagatgtaccagcctagcgctgtggtgctg
cagtgtggcgcagactccctgtctggggacagactcggttgtttcaatctaactgtcaaa
ggtcatgctaaatgtgtagaagttgtgaaaacttttaacttgccattgctgatgctcggt
ggaggaggctacacaatccggaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgaaattcccaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatctacgtatgttaccacatgcacctggtgtt
caaatgcaagctattccagaggatgctgttcatgaagacagtggagatgaggatggagaa
gacccggacaaaagaatttccattcgagcatcagacaaacggatagcttgcgatgaagag
ttttcagattctgaggatgaaggtgaaggaggtcgtaggaatgttgctgatcataagaag
ggagcaaagaaggctagaattgaagaagacaagaaggagacagaggacaagaagacagat
gttaaggaagaagacaaatccaaggacaatagtggtgagaaagcagacaccaaaggagcc
aagtcagaacaactcagcaacccttga

DBGET integrated database retrieval system