KEGG   Mus caroli (Ryukyu mouse): 110292408
Entry
110292408         CDS       T05910                                 

Gene name
Tgfbr1
Definition
(RefSeq) TGF-beta receptor type-1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04068  FoxO signaling pathway
mcal04144  Endocytosis
mcal04218  Cellular senescence
mcal04350  TGF-beta signaling pathway
mcal04371  Apelin signaling pathway
mcal04380  Osteoclast differentiation
mcal04390  Hippo signaling pathway
mcal04520  Adherens junction
mcal04659  Th17 cell differentiation
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05142  Chagas disease
mcal05161  Hepatitis B
mcal05166  Human T-cell leukemia virus 1 infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05220  Chronic myeloid leukemia
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110292408 (Tgfbr1)
   04350 TGF-beta signaling pathway
    110292408 (Tgfbr1)
   04390 Hippo signaling pathway
    110292408 (Tgfbr1)
   04371 Apelin signaling pathway
    110292408 (Tgfbr1)
   04068 FoxO signaling pathway
    110292408 (Tgfbr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110292408 (Tgfbr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110292408 (Tgfbr1)
  09143 Cell growth and death
   04218 Cellular senescence
    110292408 (Tgfbr1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110292408 (Tgfbr1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110292408 (Tgfbr1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110292408 (Tgfbr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110292408 (Tgfbr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292408 (Tgfbr1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110292408 (Tgfbr1)
   05212 Pancreatic cancer
    110292408 (Tgfbr1)
   05225 Hepatocellular carcinoma
    110292408 (Tgfbr1)
   05226 Gastric cancer
    110292408 (Tgfbr1)
   05220 Chronic myeloid leukemia
    110292408 (Tgfbr1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110292408 (Tgfbr1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292408 (Tgfbr1)
   05161 Hepatitis B
    110292408 (Tgfbr1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110292408 (Tgfbr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110292408 (Tgfbr1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110292408 (Tgfbr1)
Protein kinases [BR:mcal01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   110292408 (Tgfbr1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Psg1
Other DBs
NCBI-GeneID: 110292408
NCBI-ProteinID: XP_021015361
Ensembl: MGP_CAROLIEiJ_G0025996
LinkDB
Position
4
AA seq 509 aa
MEAAAAAPRRRQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTEKQSAGLGPV
ELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDM
TTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFR
EAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIK
LALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDT
IDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDY
QLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLT
ALRIKKTLSQLSQQEGIKIYVQVSIEILI
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgctgctccacgtcgccggcagctcctcatcgtgttggtggcggcg
gcgacgctgctcccgggggcgaaggcattacagtgtttctgccacctctgtacaaaggat
aattttacctgtgagacagatggtctttgctttgtctcagtcactgagaccacagacaaa
gttatacataatagtatgtgtatagctgaaattgacctaattcctcgagacaggccattt
gtttgtgcaccatcttcaaaaacaggggccgttactacaacatattgctgcaatcaggac
cactgcaataaaatagaactcccaactacagaaaagcagtcagctggccttggtcctgtg
gagctggcagctgtcattgctggtccagtctgcttcgtctgcattgcacttatgctgatg
gtctatatctgccataaccgcactgtcattcaccaccgtgtgccaaatgaagaggatcca
tcactagatcgccctttcatttcagagggcaccaccttaaaagatttaatttatgatatg
acaacatcagggtctggatcaggtttaccactgcttgttcaaagaacaattgccaggacc
attgtgttacaagaaagcattggcaaaggtcggtttggagaagtttggcgaggcaaatgg
cggggagaagaagttgctgtgaagatattctcttctagagaagaacgttcatggttccga
gaggcagagatttatcagactgtaatgttacgccatgaaaatatcctgggatttatagca
gcagacaacaaagacaatgggacgtggacgcagctgtggttggtgtcagattatcatgag
catggatcccttttcgattacttgaatagatacactgttactgtggaaggaatgatcaag
cttgctctgtccacagcaagtggtcttgcccatcttcacatggagattgttggtacccaa
ggaaaaccagctattgcccatagagatttgaaatcaaagaatatcttggtgaagaaaaat
ggaacctgttgtattgcagacttgggacttgctgtgagacatgattctgccacagataca
attgatattgctccaaaccacagagtaggcactaaaaggtacatggcccctgaagttcta
gacgattccataaatatgaaacattttgaatccttcaaacgtgctgacatctatgcaatg
ggcttagtattctgggaaattgctcgacgctgttctattggtggaatccatgaagactac
cagttgccttattatgatcttgtaccttctgatccatcggttgaagaaatgagaaaagta
gtttgcgaacagaagttaaggccaaatattccaaacagatggcagagctgtgaggccttg
agagtgatggctaaaattatgagagaatgctggtatgccaatggagcagctaggctgaca
gctttgcgaattaaaaaaacactgtcacaactcagccaacaggaaggcatcaaaatatac
gtgcaggtgtctatagaaattctcatttaa

DBGET integrated database retrieval system