KEGG   Mus caroli (Ryukyu mouse): 110292411
Entry
110292411         CDS       T05910                                 

Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04150  mTOR signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04530  Tight junction
mcal04611  Platelet activation
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04660  T cell receptor signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04921  Oxytocin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04972  Pancreatic secretion
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05152  Tuberculosis
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110292411
   04015 Rap1 signaling pathway
    110292411
   04310 Wnt signaling pathway
    110292411
   04350 TGF-beta signaling pathway
    110292411
   04072 Phospholipase D signaling pathway
    110292411
   04071 Sphingolipid signaling pathway
    110292411
   04024 cAMP signaling pathway
    110292411
   04022 cGMP-PKG signaling pathway
    110292411
   04150 mTOR signaling pathway
    110292411
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110292411
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110292411
   04520 Adherens junction
    110292411
   04530 Tight junction
    110292411
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110292411
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110292411
   04621 NOD-like receptor signaling pathway
    110292411
   04625 C-type lectin receptor signaling pathway
    110292411
   04660 T cell receptor signaling pathway
    110292411
   04670 Leukocyte transendothelial migration
    110292411
   04062 Chemokine signaling pathway
    110292411
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110292411
   04928 Parathyroid hormone synthesis, secretion and action
    110292411
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110292411
  09154 Digestive system
   04972 Pancreatic secretion
    110292411
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110292411
  09158 Development and regeneration
   04360 Axon guidance
    110292411
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292411
   05206 MicroRNAs in cancer
    110292411
   05205 Proteoglycans in cancer
    110292411
   05203 Viral carcinogenesis
    110292411
  09162 Cancer: specific types
   05210 Colorectal cancer
    110292411
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110292411
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110292411
   05135 Yersinia infection
    110292411
   05133 Pertussis
    110292411
   05152 Tuberculosis
    110292411
   05100 Bacterial invasion of epithelial cells
    110292411
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110292411
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110292411
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110292411
   04031 GTP-binding proteins [BR:mcal04031]
    110292411
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    110292411
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110292411
  Exosomal proteins of other body fluids (saliva and urine)
   110292411
  Exosomal proteins of colorectal cancer cells
   110292411
  Exosomal proteins of bladder cancer cells
   110292411
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    110292411
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 110292411
NCBI-ProteinID: XP_021015363
UniProt: A0A6P5PJ64
LinkDB
Position
4
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDXVREVFEMATRAALQ
ARRGKKKSGCLIL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacggtgtttgaa
aactatgtggcggatatcgaggtggatgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgcctgaggcctctctcttatccagacactgatgttata
ttgatgtgtttttccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtccaaatgtgcccatcatcctggttgggaacaagaaggac
cttcggaatgatgagcacacaagacgggagttagccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatngagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctagacgtgggaagaaaaagtctgggtgcctcatcttgtga

KEGG   Mus caroli (Ryukyu mouse): 110302438
Entry
110302438         CDS       T05910                                 

Gene name
Rhoa
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04022  cGMP-PKG signaling pathway
mcal04024  cAMP signaling pathway
mcal04062  Chemokine signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04144  Endocytosis
mcal04150  mTOR signaling pathway
mcal04270  Vascular smooth muscle contraction
mcal04310  Wnt signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04360  Axon guidance
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04530  Tight junction
mcal04611  Platelet activation
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04660  T cell receptor signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04921  Oxytocin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04972  Pancreatic secretion
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05152  Tuberculosis
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110302438 (Rhoa)
   04015 Rap1 signaling pathway
    110302438 (Rhoa)
   04310 Wnt signaling pathway
    110302438 (Rhoa)
   04350 TGF-beta signaling pathway
    110302438 (Rhoa)
   04072 Phospholipase D signaling pathway
    110302438 (Rhoa)
   04071 Sphingolipid signaling pathway
    110302438 (Rhoa)
   04024 cAMP signaling pathway
    110302438 (Rhoa)
   04022 cGMP-PKG signaling pathway
    110302438 (Rhoa)
   04150 mTOR signaling pathway
    110302438 (Rhoa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110302438 (Rhoa)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110302438 (Rhoa)
   04520 Adherens junction
    110302438 (Rhoa)
   04530 Tight junction
    110302438 (Rhoa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110302438 (Rhoa)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110302438 (Rhoa)
   04621 NOD-like receptor signaling pathway
    110302438 (Rhoa)
   04625 C-type lectin receptor signaling pathway
    110302438 (Rhoa)
   04660 T cell receptor signaling pathway
    110302438 (Rhoa)
   04670 Leukocyte transendothelial migration
    110302438 (Rhoa)
   04062 Chemokine signaling pathway
    110302438 (Rhoa)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110302438 (Rhoa)
   04928 Parathyroid hormone synthesis, secretion and action
    110302438 (Rhoa)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110302438 (Rhoa)
  09154 Digestive system
   04972 Pancreatic secretion
    110302438 (Rhoa)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110302438 (Rhoa)
  09158 Development and regeneration
   04360 Axon guidance
    110302438 (Rhoa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110302438 (Rhoa)
   05206 MicroRNAs in cancer
    110302438 (Rhoa)
   05205 Proteoglycans in cancer
    110302438 (Rhoa)
   05203 Viral carcinogenesis
    110302438 (Rhoa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110302438 (Rhoa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110302438 (Rhoa)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110302438 (Rhoa)
   05135 Yersinia infection
    110302438 (Rhoa)
   05133 Pertussis
    110302438 (Rhoa)
   05152 Tuberculosis
    110302438 (Rhoa)
   05100 Bacterial invasion of epithelial cells
    110302438 (Rhoa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110302438 (Rhoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110302438 (Rhoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110302438 (Rhoa)
   04031 GTP-binding proteins [BR:mcal04031]
    110302438 (Rhoa)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    110302438 (Rhoa)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110302438 (Rhoa)
  Exosomal proteins of other body fluids (saliva and urine)
   110302438 (Rhoa)
  Exosomal proteins of colorectal cancer cells
   110302438 (Rhoa)
  Exosomal proteins of bladder cancer cells
   110302438 (Rhoa)
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    110302438 (Rhoa)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 110302438
NCBI-ProteinID: XP_021028903
LinkDB
Position
9
AA seq 102 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLGELWHLCANP
NT seq 309 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacggtgtttgaa
aactatgtggcggatatcgaggtggatgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgcctgaggcctctctcttatccagacactgatgttata
ttgatgtgtttttccattgacagccctgatagtttaggtgagctgtggcacctgtgtgcc
aatccgtga

DBGET integrated database retrieval system