KEGG   Mus caroli (Ryukyu mouse): 110292423
Entry
110292423         CDS       T05910                                 

Gene name
Jun
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04024  cAMP signaling pathway
mcal04137  Mitophagy - animal
mcal04210  Apoptosis
mcal04310  Wnt signaling pathway
mcal04380  Osteoclast differentiation
mcal04510  Focal adhesion
mcal04530  Tight junction
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04668  TNF signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04912  GnRH signaling pathway
mcal04915  Estrogen signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05161  Hepatitis B
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05210  Colorectal cancer
mcal05211  Renal cell carcinoma
mcal05224  Breast cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05321  Inflammatory bowel disease
mcal05323  Rheumatoid arthritis
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110292423 (Jun)
   04012 ErbB signaling pathway
    110292423 (Jun)
   04310 Wnt signaling pathway
    110292423 (Jun)
   04668 TNF signaling pathway
    110292423 (Jun)
   04024 cAMP signaling pathway
    110292423 (Jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110292423 (Jun)
  09143 Cell growth and death
   04210 Apoptosis
    110292423 (Jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110292423 (Jun)
   04530 Tight junction
    110292423 (Jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110292423 (Jun)
   04621 NOD-like receptor signaling pathway
    110292423 (Jun)
   04625 C-type lectin receptor signaling pathway
    110292423 (Jun)
   04660 T cell receptor signaling pathway
    110292423 (Jun)
   04658 Th1 and Th2 cell differentiation
    110292423 (Jun)
   04659 Th17 cell differentiation
    110292423 (Jun)
   04657 IL-17 signaling pathway
    110292423 (Jun)
   04662 B cell receptor signaling pathway
    110292423 (Jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110292423 (Jun)
   04915 Estrogen signaling pathway
    110292423 (Jun)
   04921 Oxytocin signaling pathway
    110292423 (Jun)
   04926 Relaxin signaling pathway
    110292423 (Jun)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110292423 (Jun)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110292423 (Jun)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292423 (Jun)
   05203 Viral carcinogenesis
    110292423 (Jun)
   05231 Choline metabolism in cancer
    110292423 (Jun)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110292423 (Jun)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110292423 (Jun)
   05211 Renal cell carcinoma
    110292423 (Jun)
   05224 Breast cancer
    110292423 (Jun)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110292423 (Jun)
   05321 Inflammatory bowel disease
    110292423 (Jun)
  09165 Substance dependence
   05030 Cocaine addiction
    110292423 (Jun)
   05031 Amphetamine addiction
    110292423 (Jun)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110292423 (Jun)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110292423 (Jun)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110292423 (Jun)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110292423 (Jun)
   05135 Yersinia infection
    110292423 (Jun)
   05133 Pertussis
    110292423 (Jun)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110292423 (Jun)
   05170 Human immunodeficiency virus 1 infection
    110292423 (Jun)
   05161 Hepatitis B
    110292423 (Jun)
   05171 Coronavirus disease - COVID-19
    110292423 (Jun)
   05162 Measles
    110292423 (Jun)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292423 (Jun)
   05169 Epstein-Barr virus infection
    110292423 (Jun)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110292423 (Jun)
   05142 Chagas disease
    110292423 (Jun)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110292423 (Jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110292423 (Jun)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    110292423 (Jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 110292423
NCBI-ProteinID: XP_021015381
Ensembl: MGP_CAROLIEiJ_G0026170
UniProt: A0A6P5PD82
LinkDB
Position
4
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggtgcctacggctacagtaaccctaagatcctaaaacagagcatgaccttg
aacctggccgacccggtgggcaatctgaagccgcacctccgcgccaagaactcggacctt
ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgcccgagctggagcgcctgatc
atccagtccagcaatgggcacatcaccactacaccgacccccacccagttcttgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggctgaa
ctgcatagccagaacacgcttcccagtgtcacgtccgcggcacagccggtcagcggggcg
ggcatggtggctcccgcggtggcctcagtagcaggcgctggcggcggtggcggctacagc
gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg
ctgagcagcggcggtggggcgccctcctatggcgcggccgggctggcctttccctcgcag
ccgcagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg
cagcacccgcggctgcaggccctgaaggaagagccgcagaccgtgccggagatgccggga
gagacgccgcccctgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcattgccgcctccaagtgccggaaaaggaagctggagcggatc
gctcggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcatccacg
gccaacatgctcagggaacaggtggcacagcttaagcagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

KEGG   Mus caroli (Ryukyu mouse): 110307063
Entry
110307063         CDS       T05910                                 

Gene name
Fos
Definition
(RefSeq) proto-oncogene c-Fos isoform X1
  KO
K04379  proto-oncogene protein c-fos
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04024  cAMP signaling pathway
mcal04210  Apoptosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04668  TNF signaling pathway
mcal04713  Circadian entrainment
mcal04725  Cholinergic synapse
mcal04728  Dopaminergic synapse
mcal04915  Estrogen signaling pathway
mcal04917  Prolactin signaling pathway
mcal04921  Oxytocin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04932  Non-alcoholic fatty liver disease
mcal04935  Growth hormone synthesis, secretion and action
mcal05031  Amphetamine addiction
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05161  Hepatitis B
mcal05162  Measles
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05224  Breast cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05323  Rheumatoid arthritis
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110307063 (Fos)
   04668 TNF signaling pathway
    110307063 (Fos)
   04024 cAMP signaling pathway
    110307063 (Fos)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110307063 (Fos)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110307063 (Fos)
   04660 T cell receptor signaling pathway
    110307063 (Fos)
   04658 Th1 and Th2 cell differentiation
    110307063 (Fos)
   04659 Th17 cell differentiation
    110307063 (Fos)
   04657 IL-17 signaling pathway
    110307063 (Fos)
   04662 B cell receptor signaling pathway
    110307063 (Fos)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110307063 (Fos)
   04917 Prolactin signaling pathway
    110307063 (Fos)
   04921 Oxytocin signaling pathway
    110307063 (Fos)
   04926 Relaxin signaling pathway
    110307063 (Fos)
   04935 Growth hormone synthesis, secretion and action
    110307063 (Fos)
   04928 Parathyroid hormone synthesis, secretion and action
    110307063 (Fos)
  09156 Nervous system
   04725 Cholinergic synapse
    110307063 (Fos)
   04728 Dopaminergic synapse
    110307063 (Fos)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110307063 (Fos)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110307063 (Fos)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110307063 (Fos)
   05231 Choline metabolism in cancer
    110307063 (Fos)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110307063 (Fos)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110307063 (Fos)
   05224 Breast cancer
    110307063 (Fos)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110307063 (Fos)
  09165 Substance dependence
   05031 Amphetamine addiction
    110307063 (Fos)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110307063 (Fos)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110307063 (Fos)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110307063 (Fos)
   05135 Yersinia infection
    110307063 (Fos)
   05133 Pertussis
    110307063 (Fos)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110307063 (Fos)
   05170 Human immunodeficiency virus 1 infection
    110307063 (Fos)
   05161 Hepatitis B
    110307063 (Fos)
   05171 Coronavirus disease - COVID-19
    110307063 (Fos)
   05162 Measles
    110307063 (Fos)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110307063 (Fos)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110307063 (Fos)
   05142 Chagas disease
    110307063 (Fos)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110307063 (Fos)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110307063 (Fos)
   04131 Membrane trafficking [BR:mcal04131]
    110307063 (Fos)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    110307063 (Fos)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110307063 (Fos)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 110307063
NCBI-ProteinID: XP_021034937
Ensembl: MGP_CAROLIEiJ_G0017967
UniProt: A0A6P5QZR1
LinkDB
Position
12
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFT
LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYA
ADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggtttcaacgccgactacgaggcgtcatcctcccgctgcagtagcgcc
tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg
ggctctcctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt
atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact
ctggtctcctccgtggccccctctcagaccagagcgccccatccttacggactccccacc
cagtctgctggggcttacgccagagcgggaatggtgaagaccgtgtcaggaggcagagcg
cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg
agaatccgaagggaacggaataagatggctgcagccaagtgccggaatcggaggagggag
ctgacagatacgctccaagcggagacagatcaacttgaagatgagaagtctgcgttgcag
actgaaattgccaatctgctgaaagagaaggaaaaactggagtttattttggcagcccac
cgacctgcctgcaagatccccgatgacctcggcttcccagaggagatgtctgtggcctcc
ctggatttgactggaggtctgcctgaggcttccaccccagagtctgaggaggccttcacc
ctgccccttctcaacgaccctgagcccaagccatccttggagccagtcaagagcatcagc
aacgtggagctgaaggctgaaccctttgatgacttcttgtttccggcatcatctaggccc
agtggctcggagacctcccgctctgtgccagatgtggacctgtccggttccttctatgca
gcagactgggagcctctgcacagcagttccctggggatggggcccatggtcacagagctg
gagcccctgtgtactcccgtggtcacctgtactccaggctgcactacttacacgtcttcc
tttgtcttcacctaccccgaggctgactccttcccaagctgtgccgctgcccaccgaaag
ggcagcagcagcaacgagccctcctccgactccctgagctcacccacactgctggccctg
tga

KEGG   Mus caroli (Ryukyu mouse): 110310111
Entry
110310111         CDS       T05910                                 

Gene name
Sp1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04137  Mitophagy - animal
mcal04350  TGF-beta signaling pathway
mcal04915  Estrogen signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05163  Human cytomegalovirus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05224  Breast cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110310111 (Sp1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110310111 (Sp1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110310111 (Sp1)
   04928 Parathyroid hormone synthesis, secretion and action
    110310111 (Sp1)
   04927 Cortisol synthesis and secretion
    110310111 (Sp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310111 (Sp1)
   05202 Transcriptional misregulation in cancer
    110310111 (Sp1)
   05231 Choline metabolism in cancer
    110310111 (Sp1)
  09162 Cancer: specific types
   05224 Breast cancer
    110310111 (Sp1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110310111 (Sp1)
   05017 Spinocerebellar ataxia
    110310111 (Sp1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310111 (Sp1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110310111 (Sp1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310111 (Sp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110310111 (Sp1)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110310111 (Sp1)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    110310111 (Sp1)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    110310111 (Sp1)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4
Other DBs
NCBI-GeneID: 110310111
NCBI-ProteinID: XP_021038462
Ensembl: MGP_CAROLIEiJ_G0020350
LinkDB
Position
15
AA seq 719 aa
MSDQDHSMDEVTAVVKIEKDVGGNNAGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQP
SPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTAAQLSQGANGWQIISSSSGATP
TSKEQSGNSTNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQT
VDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIIPNRGSGGNIIAAMPNLLQQAVPLQGL
ANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQPVTS
GTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTPQRVGG
LQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLS
GQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQT
ITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSG
IQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRTRRE
ACTCPYCKDSEGRVAYKREKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTL
PLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaagtgacagctgtggtgaagattgaaaaagat
gttggtggcaataatgcgggtagcggcaatggtggcggtgccgccttttctcagactcga
agcagcagcacaggcagtagcagcagcagtggtggcggaggagggcaggaatcccagcca
tctcctttggctctgctggcagcaacctgcagcagaattgagtcacccaatgagaacagc
aacaactcccagggtccgagtcagtcagggggcacaggtgaacttgacctcacagccgca
caactttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccct
acctcaaaggaacagagtggcaacagtaccaatggcagcgagtcttccaagaaccgcaca
gtctctggtgggcagtatgttgtggctgctacccccaacttacagaaccagcaagttctg
acaggtctccctggagtaatgcctaatattcagtatcaagtaatcccacagttccagact
gttgatgggcagcagttgcagtttgctgccactggggcccaagtgcagcaggatggttct
ggtcaaatacagatcataccaggtgcaaaccaacagatcatcccaaatagaggaagcggg
ggcaacattattgctgctatgccaaatctactccagcaggctgtcccccttcaaggcctt
gctaataatgtgctctcaggacagactcagtatgtgaccaatgtaccagtggccctaaat
gggaacatcaccttgctacctgtcaacagcgtttctgcagctaccctgactcccagctct
caggcaggcacgatcagcagctctggatcccaggagagcagctcacagcctgtcacctca
gggactgccatcagttctgccagcttggtgtcatcacaagctagttccagctcctttttt
accaatgccaatagttattcaacaactactaccaccagcaacatgggaattatgaacttt
accagcagtggctcatcagggactagttctcaaggccagacgccccagagggttggtggg
ctacaagggtctgattctctgaacatccagcagaaccagacatcaggaggctcgctgcaa
ggaagtcagcagaaagagggagagcaaagtcagcagacacagcaacaacaaatccttatt
cagcctcagctagttcaaggaggacaagctcttcaggcccttcaagcagcaccattgtcc
ggacagaccttcacaactcaagctatttcccaggaaacccttcagaacctccagcttcag
gctgttcagaactctggtcccatcatcattcggacaccaaccgtggggcccaatggacag
gtcagttggcagacccttcagctgcagaatcttcaagttcagaatccacaagcccagaca
atcaccttggcccctatgcagggtgtttccttggggcagactagcagcagtaataccacc
ctaacacccattgcctcagctgcctccattcctgctggcacagtcactgtgaatgctgct
caactctcctccatgccaggcctccagaccattaacctcagtgcattgggtacttcaggg
atccaggtgcaccagcttccaggcctgcctttggctatagcaaacaccccaggtgatcat
ggaactcaacttggtcttcatggatctggtggtgatgggatacatgatgagacagcaggt
ggagaaggagagaatagctctgacctccaaccccaagctggtcgcaggactcgtcgggaa
gcatgtacatgcccctattgcaaagacagtgagggaagagtggcatataaaagagagaag
aaatttgcctgccctgagtgccctaagcgtttcatgaggagtgatcacctgtcaaagcat
atcaagacccaccagaacaagaagggaggcccaggtgtagccctgagtgtgggcacattg
cccctggacagtggggcaggttcagaaggcactgccactccttcagcccttattaccacc
aatatggtagccatggaggccatctgtccagagggtattgcccgtcttgccaacagtggc
atcaatgtcatgcaggtgacagagctgcagtccattaatatcagtggcaatggtttctaa

DBGET integrated database retrieval system