KEGG   Mus caroli (Ryukyu mouse): 110292517
Entry
110292517         CDS       T05910                                 

Gene name
Cdc42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04014  Ras signaling pathway
mcal04015  Rap1 signaling pathway
mcal04062  Chemokine signaling pathway
mcal04144  Endocytosis
mcal04360  Axon guidance
mcal04370  VEGF signaling pathway
mcal04510  Focal adhesion
mcal04520  Adherens junction
mcal04530  Tight junction
mcal04660  T cell receptor signaling pathway
mcal04666  Fc gamma R-mediated phagocytosis
mcal04670  Leukocyte transendothelial migration
mcal04722  Neurotrophin signaling pathway
mcal04810  Regulation of actin cytoskeleton
mcal04912  GnRH signaling pathway
mcal04932  Non-alcoholic fatty liver disease
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal05100  Bacterial invasion of epithelial cells
mcal05132  Salmonella infection
mcal05135  Yersinia infection
mcal05165  Human papillomavirus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05205  Proteoglycans in cancer
mcal05211  Renal cell carcinoma
mcal05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110292517 (Cdc42)
   04014 Ras signaling pathway
    110292517 (Cdc42)
   04015 Rap1 signaling pathway
    110292517 (Cdc42)
   04370 VEGF signaling pathway
    110292517 (Cdc42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110292517 (Cdc42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110292517 (Cdc42)
   04520 Adherens junction
    110292517 (Cdc42)
   04530 Tight junction
    110292517 (Cdc42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110292517 (Cdc42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110292517 (Cdc42)
   04666 Fc gamma R-mediated phagocytosis
    110292517 (Cdc42)
   04670 Leukocyte transendothelial migration
    110292517 (Cdc42)
   04062 Chemokine signaling pathway
    110292517 (Cdc42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110292517 (Cdc42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110292517 (Cdc42)
  09158 Development and regeneration
   04360 Axon guidance
    110292517 (Cdc42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292517 (Cdc42)
   05205 Proteoglycans in cancer
    110292517 (Cdc42)
   05203 Viral carcinogenesis
    110292517 (Cdc42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110292517 (Cdc42)
   05211 Renal cell carcinoma
    110292517 (Cdc42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110292517 (Cdc42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110292517 (Cdc42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110292517 (Cdc42)
   05135 Yersinia infection
    110292517 (Cdc42)
   05100 Bacterial invasion of epithelial cells
    110292517 (Cdc42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110292517 (Cdc42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110292517 (Cdc42)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110292517 (Cdc42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110292517 (Cdc42)
   04031 GTP-binding proteins [BR:mcal04031]
    110292517 (Cdc42)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    110292517 (Cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    110292517 (Cdc42)
  Macropinocytosis
   Ras GTPases
    110292517 (Cdc42)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110292517 (Cdc42)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   110292517 (Cdc42)
  Exosomal proteins of breast milk
   110292517 (Cdc42)
GTP-binding proteins [BR:mcal04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    110292517 (Cdc42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 110292517
NCBI-ProteinID: XP_021015504
Ensembl: MGP_CAROLIEiJ_G0026674
UniProt: A0A6P5PJJ9
LinkDB
Position
4
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgttggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaattcccatcagaatatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatacactcttggactttttgatactgcaggg
caagaggattatgacagactacggccgctaagttatccacagacagatgtttttctagta
tgtttctcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcccattactccagag
actgctgaaaagctggcgagggatctgaaggctgtcaagtatgtggagtgctccgccctc
acacagaaaggcctaaagaatgtgtttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system