KEGG   Mus caroli (Ryukyu mouse): 110292680
Entry
110292680         CDS       T05910                                 

Gene name
Mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal01522  Endocrine resistance
mcal04012  ErbB signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04072  Phospholipase D signaling pathway
mcal04136  Autophagy - other
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04213  Longevity regulating pathway - multiple species
mcal04218  Cellular senescence
mcal04371  Apelin signaling pathway
mcal04613  Neutrophil extracellular trap formation
mcal04630  JAK-STAT signaling pathway
mcal04659  Th17 cell differentiation
mcal04714  Thermogenesis
mcal04910  Insulin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04930  Type II diabetes mellitus
mcal04931  Insulin resistance
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05014  Amyotrophic lateral sclerosis
mcal05016  Huntington disease
mcal05017  Spinocerebellar ataxia
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05212  Pancreatic cancer
mcal05214  Glioma
mcal05215  Prostate cancer
mcal05221  Acute myeloid leukemia
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
mcal05231  Choline metabolism in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110292680 (Mtor)
   04371 Apelin signaling pathway
    110292680 (Mtor)
   04630 JAK-STAT signaling pathway
    110292680 (Mtor)
   04066 HIF-1 signaling pathway
    110292680 (Mtor)
   04072 Phospholipase D signaling pathway
    110292680 (Mtor)
   04151 PI3K-Akt signaling pathway
    110292680 (Mtor)
   04152 AMPK signaling pathway
    110292680 (Mtor)
   04150 mTOR signaling pathway
    110292680 (Mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110292680 (Mtor)
   04136 Autophagy - other
    110292680 (Mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    110292680 (Mtor)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110292680 (Mtor)
   04659 Th17 cell differentiation
    110292680 (Mtor)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110292680 (Mtor)
   04920 Adipocytokine signaling pathway
    110292680 (Mtor)
   04935 Growth hormone synthesis, secretion and action
    110292680 (Mtor)
   04919 Thyroid hormone signaling pathway
    110292680 (Mtor)
  09149 Aging
   04211 Longevity regulating pathway
    110292680 (Mtor)
   04213 Longevity regulating pathway - multiple species
    110292680 (Mtor)
  09159 Environmental adaptation
   04714 Thermogenesis
    110292680 (Mtor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110292680 (Mtor)
   05206 MicroRNAs in cancer
    110292680 (Mtor)
   05205 Proteoglycans in cancer
    110292680 (Mtor)
   05230 Central carbon metabolism in cancer
    110292680 (Mtor)
   05231 Choline metabolism in cancer
    110292680 (Mtor)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110292680 (Mtor)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110292680 (Mtor)
   05212 Pancreatic cancer
    110292680 (Mtor)
   05225 Hepatocellular carcinoma
    110292680 (Mtor)
   05226 Gastric cancer
    110292680 (Mtor)
   05214 Glioma
    110292680 (Mtor)
   05221 Acute myeloid leukemia
    110292680 (Mtor)
   05215 Prostate cancer
    110292680 (Mtor)
   05224 Breast cancer
    110292680 (Mtor)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110292680 (Mtor)
   05014 Amyotrophic lateral sclerosis
    110292680 (Mtor)
   05016 Huntington disease
    110292680 (Mtor)
   05017 Spinocerebellar ataxia
    110292680 (Mtor)
   05022 Pathways of neurodegeneration - multiple diseases
    110292680 (Mtor)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110292680 (Mtor)
   04931 Insulin resistance
    110292680 (Mtor)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110292680 (Mtor)
   05168 Herpes simplex virus 1 infection
    110292680 (Mtor)
   05163 Human cytomegalovirus infection
    110292680 (Mtor)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110292680 (Mtor)
   05165 Human papillomavirus infection
    110292680 (Mtor)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110292680 (Mtor)
   01522 Endocrine resistance
    110292680 (Mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110292680 (Mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110292680 (Mtor)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110292680 (Mtor)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   110292680 (Mtor)
Membrane trafficking [BR:mcal04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    110292680 (Mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N HEAT_EZ EPSP_synthase Nipped-B_C
Other DBs
NCBI-GeneID: 110292680
NCBI-ProteinID: XP_021015836
Ensembl: MGP_CAROLIEiJ_G0026800
UniProt: A0A6P5PQB2
LinkDB
Position
4
AA seq 2549 aa
MLGTGPAAATASAATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQPNALVGLLGYSSPQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAASGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKEDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTAHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAASAAAATSTEGSNSESEAESNENSP
TPSPLQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSASQSVEILDG
VELGEPAHKKAGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttgggacgggtcctgccgcggccaccgccagtgccgccacatctagcaatgtgagc
gtcctgcagcagttcgccagtggactgaaaagccggaatgaggagaccagggccaaagca
gccaaggagctccagcactacgtcaccatggagcttcgagagatgagtcaggaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaagggtggcatcttggccatcgccagcctcataggagtggaaggtgggaat
tccaccagaattggcagatttgccaactaccttcgaaacctcctcccctcaagtgatcca
gttgtcatggaaatggcatccaaggccattggccgcctggcgatggcaggggacactttc
actgctgaatatgtggagtttgaagtgaagcgagccttggagtggctgggtgctgaccga
aatgagggccggagacatgccgctgtcctcgttctccgggagctggccatcagtgtcccc
accttcttcttccagcaagttcagcccttctttgacaacatttttgtggctgtgtgggac
cccaagcaggccatccgggagggagctgtagcagcccttcgtgcctgtctgattctcacc
acacagcgggaaccgaaggagatgcagaagcctcagtggtaccggcacacatttgaagaa
gcagagaaaggttttgatgagaccctggccaaagagaagggtatgaatcgagatgatcga
atccacggagccttgctgatcctcaacgagctagttcgtatcagcagcatggagggagag
cgtctgagagaagagatggaggagatcacccagcaacagctggtgcatgacaagtactgc
aaagacctcatgggcttcgggaccaagcctcggcacatcacgcccttcaccagtttccag
gctgtgcagccccagcagccgaacgccttggtgggactgctggggtacagctccccccaa
ggcctgatgggatttgggacatcccccagccctgccaagtccactctggtagaaagccgc
tgttgcagagacttgatggaagagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggagcagcaagaactcgctgatccagatgacaatccttaacctgctgccccgcctggct
gcattccgaccgtctgccttcacagatacccagtacctccaggacaccatgaaccatgtc
ctgagctgtgtcaagaaggagaaggaacggactgcggcgttccaggccctggggctgctt
tctgtggcggtgaggtcggagtttaaggtctacttgccccgtgtacttgacatcatccga
gcagccctgcctccgaaggactttgcccacaagaggcagaaaactgtgcaggtggatgcc
acggtattcacgtgcatcagcatgctggcgagagcaatggggccaggcatccagcaggac
atcaaggagctgctggagcccatgttggcagtgggcctgagccccgccctcactgctgtg
ctctatgacctgagccggcagattccacagctgaagaaagatattcaggacggccttctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaaaggc
ctggcccaccagctggcctcccctggtctcaccaccctccctgaggccagcgatgtggcc
agcatcactcttgcccttcgaacccttggcagctttgaatttgaaggccactctctgacc
cagttcgtccgacactgcgcagatcacttcctgaacagcgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcttgctcacaccctccatccacctcatcagcggccat
gcccacgtggttagccagactgcagtgcaggtcgtggcagatgtgctcagcaagctgctc
gtggttggcataacagatcctgaccctgatatccgctactgtgtcttggcatccctggac
gagcgctttgatgcccacctggcccaggcagaaaacttacaagctctgtttgtggctctg
aatgaccaggtctttgagatccgcgagctggccatctgcactgtgggccgactaagcagc
atgaacccagccttcgtcatgcctttcctgcgcaagatgctcatccagatcctgacagag
ctggagcacagcggcattgggagaatcaaggagcagagcgcccgcatgctggggcacctg
gtgtccaatgccccccggctcatccgcccctacatggagcctatcctgaaggctttaatt
ttgaaactgaaagatccagatcctgacccaaacccgggcgtgatcaataacgtgttggcc
actataggagaactggctcaggtgagcggcctggaaatgcggaagtgggttgatgagctc
tttatcatcatcatggacatgctacaggactcctccctgctggccaaaaggcaggtggct
ttgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacaggaag
taccctactctgcttgaagtgctgctgaatttcctgaagacggagcagaaccagggcact
cggagagaggctatccgagtgttgggactccttggggctttggatccctacaagcacaaa
gtgaacatcggcatgatcgaccagtcccgggacgcttccgctgtcagcctgtcagagtcc
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcccctggacgagttctaccccgctgtgtccatggtggccttgatgcggatcttccga
gatcagtccctctctcaccaccacaccatggtggtgcaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattccttaatgtc
atccgagtctgtgatggggccatccgggaatttctgttccagcagctggggatgctggtg
tcctttgtgaagagccacatccgtccctacatggatgaaatagtcaccctcatgagagag
ttttgggtcatgaacacgtcgatccagagcacaatcattcttctcattgagcagattgtg
gtggctcttggaggggaatttaagctctatctgccccagctgatcccacacatgctgcgg
gtcttcatgcatgacaacagccaaggccgcatcgtctccatcaagctgttagcggccatc
cagctgtttggtgccaacctggatgactatctgcacttgttgttgcctccgattgtgaaa
ttgtttgatgcccctgaagtcccgctgccatcgagaaaggcagcgctggagacggtggac
cgcctgacagagtccttagatttcactgactacgcctcccgcatcattcacccaatcgtt
cgtacgctagaccagagcccagagctgcgctccacagccatggacacactgtcttcactt
gtctttcaactggggaagaagtaccagatcttcattccaatggtgaataaagtcctcgtg
cgacaccggatcaaccaccagcgctatgatgtgcttatctgcagaatcgtcaaggggtac
acacttgctgatgaggaggaagaccctttgatttaccagcatcgaatgctaaggagcagc
cagggagatgccctggccagtggaccagttgagacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcttggggagctgccagaagggtctccaaggacgactgg
ctggagtggctgaggcgcttgagtctggagcttctgaaggactcctcatctccctccctg
cgctcatgctgggccctggcgcaggcctacaaccccatggccagggatctcttcaatgct
gcctttgtatcctgctggtctgagctgaatgaagaccaacaagatgagctcatcaggagt
attgagttggctctcacttctcaagacattgctgaagtcacacaaaccctcctgaacttg
gctgagttcatggaacacagtgacaagggccccctgcctctgagagatgacaatggcatc
gtgctcctgggtgagagagctgccaagtgccgggcatatgccaaagcactgcactacaaa
gaactggagttccagaaagggcccacgcctgccatacttgagtccctcatcagcattaac
aataagctacagcagcctgaggcagcttctggggtgctggaatacgccatgaaacacttt
ggagagctggagatccaggccacctggtatgagaagctgcatgagtgggaggatgctctc
gtggcctacgacaagaagatggacacaaacaaggaagacccggagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatggggccagcttcatcagcagtgctgtgaaaag
tggactctggttaatgatgagacccaggctaagatggcccggatggctgctgctgcagca
tggggtttaggtcagtgggacagcatggaggagtacacctgcatgatcccgagggacacc
cacgatggagccttttacagggcagtgttggctctacatcaggatctcttctccttggcc
cagcagtgcattgacaaggccagggacctgctggatgcagagctgactgccatggcagga
gagagctacagccgagcctatggggccatggtttcttgccacatgctgtccgagttggag
gaggttatccagtacaaacttgtccctgagcgtcgggagatcatccggcaaatctggtgg
gagagactgcagggctgccagcgtattgttgaggactggcagaaaatcctcatggtccgg
tcccttgtggtcagccctcatgaggacatgagaacctggctcaagtatgcaagcctgtgt
ggcaagagtggcagactggctcttgctcataaaaccttagtgttgctcttgggagttgat
ccatctcggcaacttgaccatcctctgccaacagctcaccctcaagtgacctatgcctac
atgaagaacatgtggaaaagcgctcggaagatcgatgccttccagcacatgcagcacttt
gtgcagaccatgcagcagcaggcccagcatgccatcgccacagaggaccagcagcacaag
caggagctgcataagctcatggccaggtgttttctgaaacttggagagtggcagctgaac
ctccagggcatcaatgagagcaccatccccaaggtgctacagtactacagtgccgccaca
gagcacgaccgcagctggtacaaggcttggcacgcatgggcagtgatgaacttcgaagca
gtgctacactacaaacatcagaaccaagcccgtgatgagaagaagaagctgcgtcatgcc
agcggggccaacatcaccaatgccaccactgcagccaccactgcagcctctgctgctgct
gccaccagcacagagggcagcaacagtgagagtgaagctgagagcaatgagaacagcccc
accccgtcccctctgcagaagaaggtcaccgaggatttatccaaaactctcttgttgtac
actgtccctgctgttcaaggcttcttccgttctatctccttgtcaagaggcaacaatctc
caggatacactcagagtcctcaccttgtggtttgattatggtcactggccagatgtcaat
gaagccttggtggaaggggtgaaggccatacagattgacacttggttacaggttatacct
cagctcattgcaagaattgacacacccagacccttggtgggccggctcattcaccagctt
ctcacagatattggtcggtaccacccacaggccctcatctaccccctgacggtggcttct
aagtctaccaccacagcccgtcacaatgcagccaacaagatcttgaagaacatgtgtgag
cacagcaacacgctggtccagcaggccatgatggtgagtgaagagctgattcgggtagcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgcttgtactttggg
gagcggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaacgg
ggtccccagactctgaaggaaacatcctttaatcaggcatatggccgagatttaatggag
gcacaagaatggtgtcgaaagtacatgaagtcagggaacgtcaaggatctcacgcaagcc
tgggacctctactatcacgtgttcagacggatctcaaagcagctaccccagctcacatcc
ctggagctgcagtatgtgtcccccaaacttctgatgtgccgagaccttgagttggctgtg
ccaggaacatacgaccccaaccagccgatcattcgcattcaatccatagccccatctttg
caagtcatcacatccaagcagaggcctcggaagctgactctgatgggcagcaatgggcac
gagtttgttttcctcctgaaaggccatgaagatctgcggcaggatgaacgagtgatgcag
ctctttggcctggtgaacacactcctagccaatgacccaacttctcttcgcaagaacctc
agcatccagagatacgctgtcatccctctgtccaccaactcgggcctcattggctgggtg
ccccactgtgacacactgcatgccctcatccgggactacagagagaagaagaagatcctg
ttgaacatcgagcatcgcatcatgctgcggatggctcctgactatgaccacctaactttg
atgcagaaggtagaggtgtttgagcatgctgtcaacaacacagctggggacgacctggcc
aagctactgtggctaaaaagccccagctcggaggtatggtttgaccgaagaaccaactat
acccgctccctggccgttatgtcgatggttggatacattttaggccttggagacaggcac
ccatctaatctgatgctggaccggctgagtgggaagatcctgcacattgactttggggac
tgctttgaggtcgctatgaccagagagaaatttccagaaaagattccatttagactaaca
aggatgttgaccaatgctatggaggttacgggtctggatggcaactacagaaccacatgc
cacacagtgatggaagtgcttcgggaacacaaggacagtgtcatggctgtgctggaagcc
tttgtctatgaccctctgctcaactggaggctgatggacacgaataccaaaggcaataag
cggtcccggacaaggacagactcctactctgccagccagtcagtagaaattttggacggt
gtagaacttggagaaccagcccataagaaagcagggaccactgtgccagaatccatccat
tcattcattggagacggtttggtgaaaccagaagccttaaacaagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggatttctctcatgatgacactttggat
gttccaacccaagtggagctgcttatcaagcaagcaacatctcatgagaacctctgccag
tgctacatcggctggtgtcccttctggtaa

DBGET integrated database retrieval system